KEGG   Drosophila simulans: Dsimw501_GD22254
Entry
Dsimw501_GD22254  CDS       T01065                                 

Gene name
Dsim_GD22254
Definition
(RefSeq) uncharacterized protein
  KO
K12311  lysosomal alpha-mannosidase [EC:3.2.1.24]
Organism
dsi  Drosophila simulans
Pathway
dsi00511  Other glycan degradation
dsi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dsimw501_GD22254 (Dsim_GD22254)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Dsimw501_GD22254 (Dsim_GD22254)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     Dsimw501_GD22254 (Dsim_GD22254)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2 HemN_C
Other DBs
NCBI-GeneID: 6731833
NCBI-ProteinID: XP_002078968
FlyBase: FBgn0193662
UniProt: A0A0J9R135
LinkDB
Position
2L
AA seq 987 aa
MEYLGGTLAFIALFLLNTAICETTCGFEACPAPKLNMINVHLVPHSHDDVGWLKTVDQYY
YGSQNKIQHAGVQYILDTVVEELLKDSSRRFIQVETFFFAKWYSEQNETVQRAVKKLVAQ
GRLEFAGGAWSMNDEATVHYQSVIDQFNLGLRYLKDTFGECGRPTVGWQIDPFGHSREMA
SMFAQMAFNGEFFARMDYVDKKQRMLDLEMEMIWQSSEFLKNSNIFTGMLYNHYAAPPGF
CFDINCEDAPIIDGDSYDNNVDARVSEFIDYVKNMAKSYRSTHIMVPMGDDFQYEDAAVN
FKNMDKLIKYVNDRQSTGSQVNVFYSTPSCYLYELHQLKQTWPNKTEDFFPYSSDSHSYW
TGYFTSRPTQKRFHRDGNHFFQTVKQLSVLANLSGTQHSEDLDNLSQAMGIMQHHDAVTG
TEKQAVASDYDRMLFKAIVGAENSARDALRSLTNLTSGEFKSCLELNISVCTFTQDTANN
VIVTLVNPLAHSSTQYVRVPAKNENYIVTDEKGREVFSEVIPVPWQVLALEHRSNDTQHE
LVFKASVDKIANFLIRVLPTPKNIAEDQVYFPAERSQDELTVETSLVKLTFDTTTGGLKT
VEMNGLTENIQQTFGIYKGYRGNNGESKNRSSGAYVFRPSGDIEIVNNKVELSFYNGTKV
KEVHQHVNEWISQVIRIYEDVNRVEFEWLVGPIPTDDDVGKEIITRFSSNISSKGKFYTD
SNGREILERERNQREHFTPDMSEAISGNYYPVTGQISLQDDEKRITLLNDRAQGGSSLKD
GELELMLHRRLLNDDAFGVGEALNEIQYGTGLIARGKIYLILDAVAGKPNQRLLQHQLDQ
HFWKFFSKSNGVASVNKNMMIPDFFGIPKSVELLSLEPYSKDQILIRMENFNTEGNVVSF
NIYPLFESLSGYQIWETTLDGNMLLEDVKRFKFAQDGTGTIPSSVEYYHAPHNPLTANST
MDASGFVVTLVPMQIRTFIIQQKYIPS
NT seq 2964 nt   +upstreamnt  +downstreamnt
atggaatacttgggtggcacactcgcatttatcgcactgtttctactgaacacagcgata
tgcgagacaacctgtggattcgaggcatgtcccgcaccgaaactcaacatgatcaatgtg
cacttggtgccgcattcgcacgacgacgttggatggctaaagacagtggatcagtattat
tatggtagtcagaacaagatacagcacgctggagtccagtacattttggacaccgtggtg
gaggagctcctcaaggattcgtcgaggcgcttcatccaggtggaaacgtttttcttcgca
aaatggtattcggagcaaaacgaaacggtccaaagggcggtgaagaagttggtggcccag
ggacgtttggaattcgcgggtggagcttggagcatgaacgatgaggccaccgttcactac
caaagtgttatagatcagttcaatctgggtttaagatatcttaaggatacttttggcgag
tgtggacgccccacagttggttggcaaatcgatccatttggtcattcccgggaaatggcc
tccatgttcgcacaaatggcatttaatggtgaatttttcgcacgcatggactacgttgat
aagaagcaacgtatgctggatctggaaatggagatgatttggcagtcgagcgagtttcta
aagaactcgaatatattcactggcatgctctacaatcactatgcagctcctccgggattc
tgtttcgatatcaattgcgaggatgcaccaattatcgatggcgatagctatgataataac
gtggatgcgagggtcagtgagtttatagactatgtgaagaacatggccaagtcatatcga
tccactcacatcatggtgcccatgggagatgattttcagtacgaagatgcggcagttaac
ttcaagaatatggacaaacttatcaagtacgtcaacgatcgccaatcgacgggatcccaa
gtcaacgtattttactccacaccctcgtgttatctttatgaattgcaccaattgaagcaa
acttggccaaacaaaacggaggacttctttccgtattccagcgattcgcactcctactgg
acaggatacttcacctcacgacccacccaaaagcgtttccacagggatggcaatcacttc
tttcaaactgttaaacagctgagtgtgttggccaatttgagtggcacccagcactccgaa
gatctggataatctcagtcaggcaatgggcataatgcagcatcatgatgctgttacgggt
accgaaaaacaggcggtggccagcgactacgatcgcatgttgttcaaggccatcgttgga
gctgaaaacagtgctcgggatgccctacgatctttgaccaatctgacctccggggagttc
aagagttgcctggaactgaacataagtgtttgtaccttcacccaggatactgccaacaat
gtgattgtgacccttgttaatcctttggctcattcttcaacccaatatgtgcgtgttccg
gcgaagaacgaaaactacatagtcaccgatgagaaaggtcgtgaagtgttttcggaagtg
attcccgttccttggcaagttttggcgctggaacatcgatctaatgatacccagcacgag
ttggtttttaaagccagtgttgataaaatagcaaactttttgattcgcgtgctaccaaca
ccgaaaaatattgcagaagatcaagtctattttcccgcagagagaagccaggatgagtta
acagtagagacttcgctggtaaaactgacctttgataccacaacgggtggcttgaaaact
gtggaaatgaacgggcttacggaaaatattcagcagacctttgggatatacaagggttat
cgcggcaataatggtgaatcgaaaaaccgatcatccggcgcttacgttttccgtccatct
ggcgatattgaaatagtaaacaacaaggtggagctatcattctataatggcaccaaggtt
aaggaagtccatcagcatgtcaacgaatggatctcacaggtaatccggatctatgaggac
gtgaatcgtgttgaatttgaatggctagtcgggccgattccaacggatgatgatgttggc
aaggagataatcacacggttttccagcaatatatcctcaaagggcaagttctacaccgac
tcaaatggtcgggaaatcctggagcgagagagaaatcagcgggagcacttcactccggat
atgtcggaggccataagtggaaactattacccggtgactgggcaaatttcgctgcaagat
gacgaaaagcgaatcaccctgctgaatgatagagcccagggaggatccagtctgaaggat
ggcgaactggagctgatgctccatcgtcgtctcctgaacgatgatgcatttggagtgggt
gaagctctaaatgagatacaatatggaactggtttgattgcaagaggaaagatctaccta
atcctcgatgctgttgctggaaaaccaaatcaaagattgctgcaacaccagttggatcaa
cacttctggaagttctttagcaagtccaatggcgtcgcctctgtaaacaagaacatgatg
attcccgactttttcggtattcccaaatccgtcgaattgctttccttggaaccctattca
aaggaccaaatattaatacgaatggagaacttcaatacggaaggaaacgtagttagcttc
aacatttacccactttttgagtcgctaagtggatatcagatttgggaaaccactctggat
ggcaatatgctgttggaggacgtaaagagattcaaatttgcccaagatggcaccggtacc
attccttcctccgttgaatattaccatgctcctcacaatcccttgacggccaattcaacg
atggacgcctccggattcgtggttacactggttcccatgcagattcgcacatttataatc
caacaaaagtatattccatcatga

DBGET integrated database retrieval system