KEGG   Drosophila simulans: Dsimw501_GD22287Help
Entry
Dsimw501_GD22287  CDS       T01065                                 

Gene name
Dsim_GD22287
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dsi  Drosophila simulans
Pathway
dsi00562  Inositol phosphate metabolism
dsi01100  Metabolic pathways
dsi04068  FoxO signaling pathway
dsi04070  Phosphatidylinositol signaling system
dsi04140  Autophagy - animal
dsi04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsimw501_GD22287 (Dsim_GD22287)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Dsimw501_GD22287 (Dsim_GD22287)
   04070 Phosphatidylinositol signaling system
    Dsimw501_GD22287 (Dsim_GD22287)
   04150 mTOR signaling pathway
    Dsimw501_GD22287 (Dsim_GD22287)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dsimw501_GD22287 (Dsim_GD22287)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dsi01009]
    Dsimw501_GD22287 (Dsim_GD22287)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dsimw501_GD22287 (Dsim_GD22287)
    3.1.3.48  protein-tyrosine-phosphatase
     Dsimw501_GD22287 (Dsim_GD22287)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     Dsimw501_GD22287 (Dsim_GD22287)
Protein phosphatases and associated proteins [BR:dsi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    Dsimw501_GD22287 (Dsim_GD22287)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 6731765
NCBI-ProteinID: XP_016024446
FlyBase: FBgn0193695
UniProt: A0A0J9QZX0
LinkDB All DBs
Position
2L
AA seq 514 aa AA seqDB search
MANTISLMSNVIRNVVSKKRIRYKEKGYNLDLTYINDNIIAMGYPAPDKLEGLFRNRLED
VFKLLEENHAQHYKVYNLCSERSYDVDKFHGRVAVYPFDDHNPPTIELIQRFCSDVDLWL
KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGLKKSADEALAWYDEKRTKDRKGVTIPSQR
RYVQYFSKLVCSSVPYSKVSLNVCEIRFSESSCVQNLGTVECSVSVLHDSATENSKPDIL
KTFAIDFQESFVLTIKPSLPVSGDVKFKLTQKSPDKIIGHFWLNTYFVRNYSPCESNGTV
NKYIHTLSKSEIDDVHKDSEHKRFSEEFKISIVFEAENFSNDVQAEASEKERNENVLNFE
RSDYDSLSPNCYTEKKVLTAIVNDNTAKSQTIETLDHKDIVTKIQYDTSTNSKNTSTACK
RKQPNSKTLLPSLNDSTKEEIKRNHIFNQPSIKKTDLIKWQNSEVHITSDTRSINENKNI
NYNSYITCKQSSPKFNCGTEDGEEDWESGESTYL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggccaacactatttcgttaatgtccaacgtgatacgcaatgtagtgagtaaaaaacgt
atacgatacaaagaaaaaggatacaatttggatttaacatacattaatgataacataatt
gccatgggctatccagcaccggataaactagagggcctattcagaaatcgtctggaagat
gtcttcaagctattggaagagaatcatgcccagcattataaagtctataacctatgctcg
gagcgtagttacgacgttgataaatttcacgggagagtagctgtttatccgttcgatgat
cataaccctccaacgattgagttaatacaacgattttgcagtgatgttgatttgtggctc
aaggaagattcgtccaatgtcgtagccgtgcactgtaaagctggaaaaggcagaaccggt
accatgatctgtgcatatttagtgttcagtggacttaaaaaatccgccgacgaggcacta
gcgtggtatgatgagaagcgtacaaaggaccgaaaaggtgtgacaatcccatctcagcgt
cgatatgttcagtatttttccaaactagtttgttcaagtgttccatattcgaaagtaagc
cttaacgtatgtgaaatacgcttctcggagtccagttgtgtgcaaaacttaggcacggta
gaatgttcagtatctgtattacacgactcagccacagaaaattcaaagccagatatactg
aaaacctttgcgattgattttcaagaatcatttgttttgaccattaaaccatcattacca
gtttccggcgatgtaaaattcaaactcacacaaaaatcaccagataaaatcattggtcac
ttttggctaaacacgtattttgtgcgaaactattcaccttgcgagtccaatggaacagtt
aacaaatatatacacactttaagcaaatcggaaatcgatgatgtacataaagacagcgaa
cataaaaggttttcagaggaattcaagatttcaatcgttttcgaggcagaaaattttagc
aatgatgttcaagctgaagcgtccgaaaaagagagaaacgaaaatgttttaaatttcgaa
agatcagactatgacagtttgtcgccaaactgctataccgaaaagaaagtcttaactgcg
atcgtcaatgataatacagcgaaaagtcaaacaatagaaacgttggatcataaggatata
gttactaaaattcaatacgacacatcaaccaattcaaaaaatacttcgactgcgtgcaaa
cgcaaacagcctaatagcaaaactcttttaccaagcttgaatgattccacaaaagaggaa
ataaaacgaaatcatatatttaatcaaccgtccattaagaaaactgatttaatcaaatgg
cagaatagtgaagttcatatcacctctgacactcgaagtataaacgaaaataagaacatc
aattacaattcatacatcacatgtaaacaatcctctccaaaattcaactgtggtaccgaa
gatggcgaggaagattgggaatccggtgaatcaacatacctgtaa

DBGET integrated database retrieval system