KEGG   Drosophila simulans: Dsimw501_GD23620
Entry
Dsimw501_GD23620  CDS       T01065                                 

Gene name
Dsim_GD23620
Definition
(RefSeq) uncharacterized protein
Organism
dsi  Drosophila simulans
SSDB
Motif
Pfam: DUF1943 Vitellogenin_N DUF1081 VWD C8 DUF5520
Other DBs
NCBI-GeneID: 6731655
NCBI-ProteinID: XP_016024337
FlyBase: FBgn0194997
UniProt: A0A0J9QYW7
LinkDB
Position
2L
AA seq 4333 aa
MGGLKPQAAIWLLLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAV
RTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNNDESDSSEKTKEY
DYYDNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNI
KKGILSAFQNTMMRFDVDANTTETDVSGQCHVQYALEDTDSSYVLIRKTKDINSCRQRYA
THSVLQTTPYTFRDDKTIWPILKSQSYCNLTIDNNVYKEVKCLETHLLVPFSNASSGALT
TSTSRLKLDGVESYSAGEFLEQNPELVDRRATLVFDHTPAVKPSHDEIKAARELLVEMCR
VGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASY
KVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTLGATAV
VHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSS
AFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHRSYFLDNYGNYTLNSELRIYSYLQA
MRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFK
MDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFT
ARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKR
KAQQQARASEEEEDEDYDFEESLESNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPR
AQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQAKNILSGKEFTYTKSRVFLDASYTV
PLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDMF
WEQSGIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSELLVQKREEQLP
QEGIAKRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKS
DLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNR
VSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMELRRHQDFTAWIYNPRMLLAINGVNITG
LAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQTEITTSTNMTIKYRFQANKIEEI
NFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMINYNNAPDYVN
PNYTSLVRLVFARSQADDTFLDEMQTRASLELKLPRSKIDYRILVRHKEHMKNGTEHNVI
VGLKYAPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVNEKVTKDYIIFIN
GSWFTGHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLNIIYRRKQLLIFYDIQAK
YDQDPYGLTIQYASNDHNRNTNAEVRLKVKERDYWINAKLLSEQPKLLQLEIHMDKIRDV
HIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNNPGTKHYDGNLMITYPERTINF
GFNSFTGGPKYFGKLHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPFKGWRVNSLD
AGIYSLQNLILVNSTLFWAGDQKLQVGYKSDYDVSDQLMSFDVRFGINSTIRDIPTINVR
VKHWMDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLVHLVSPFKGYEK
GGLVAHFSLSDQRVVSGAASLNFDLREFTLTMNGYVKKFTDNMLTVNITTPLEKFRTINA
RFGLNEKKRHAVAEVRAPTAALGVEVLADVKNLLNFDVKLSVATPIESFQQAAIFALFNP
EHVDMRGLWNNVTLGFTGVWHMQNITDFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQL
HGKMSNYKLGVKINGKPKSDLVNQLGSNKMELEMLYDADFKPLNAEMDYKPDADEEYFSY
FTDFQVDTLVWPTIVGNVDIQEIIDFYLVVGHVELPQGKVEFKDRLHYPDYINVHNLLTV
TTPFAVAKNIKSIVEYHVDLHFNAFYERVKFVVNDDKDNTQELGFVFNYTALQDNVKPKA
HDVQITLLTPYEMLHEIYVHGHLELDENAYKGNISAVTAHTHLSMAASIENEDSFLETSV
GILLETDAIPHYGCQVYFKKDFSAVDKAIDIRFEVTDNGTLNQLHIATDWHTDPSYIVNA
NGRIKTTMLPLQMASTSVLVVKGQNPQLNFDLNLLSQNGQSIGYGARANKKKDVFNIEVW
TPMKNFRNISMHGTAIRSPRDSGRYDVSGFLYRNMATYGVTGAVRMTDSLPIDVVLRVQP
KAGGRDGVIELNIHEAGPKKIRFSFSAIEDGKMCQMSGGYSVSETNGAMDFSVLVESTEP
EIARINFYGNLSPNSEGSLVGDLNLETPWKELGIDTVHLHSDVGFVNERGHIVGEYKIGQ
YIGRGSCLWSWILAEDMQLVLENYLERPNAKPRIVHASAKYQNPGQTYAQLQAGGRLSVD
SKWNLDVNGSAEYKSVDDFKFRVITALPLPVGDRHQLSASYQGNVISKQFNNPDFVLETS
YESVEAQNKLLSRISYKNATNNQKGLGHVEWGKIQNLSVVEGDFELLHKQGAQKEFSARM
ITPKFKNEHTFALTGSYDLEKSGHHNVVGALDYPASRRITDLDVSFSSLSNMHGIFNSTL
PTFLNVSWLKTDFNFTTNNGKSYRYCRCFWPQDSAYFKLNSNYDSDSNNFNHNLNGNVEI
EVPLATRHRADMVYGLQKRRNQDAGNVKVVYNEKQVLDGKYKRVEQAKAPIYKETTDISL
ENEVKPLGIHFVSTRDASDPAGTQDVKHIEVYELRNTQNFNLTGELHSRATLKAQDFKVV
AIHPNRAVVLSTKYEDVSPEVVRHHSKLELSETAWIGYNLELGNFSKVGNESQSFALEIF
YPKRNLSSSGQYYMTDTNFNSDLSFQWLGGNYDQQPKTIHSNLQWKAEPLHRGDREHRTI
ALTVAHPLLEKDINCKATYYRGLRDLLRTHLTIDYSESPDQLIELGAQLTDRYSELGHTN
YTFHVYGKHIASELDVQLNGTLAARNSYYKTESTAHYKRDIFPARYGKFLALLDVNKREL
EYERQSPFHAVRLHLLPTIRYPIYGLNATIWDTPDTNHSGYIYIDMLERYARMDFNLTED
ASQNLQMVGYIPDTRSAFLDIWRNYEEIRVIDVSSYLKMNHSRLITGRFHWRPSIRQEVR
EKIQAVGKSVYSSFSEGIDFWIKSIYTETTESMGVVWNTAKQYNRDFIDDIGQLSVLEED
LADLRLFVNQSYEANDFYIKNVVNFTLTILDELAIRDHIESLPKIFSELWQAMGDSGKAL
RNSIVWLIDTIKTTYNNLLDAVSRFFHGESLVYISALLEKGIAKYDSFIKDLHIKFIKYI
ENLWHKTWTLAENHWKAVLKRFEPHLFKMISFIETTAWNLSKEVFDFIYKRTNELAESPY
FNKVSSFTADAERLYRDFKANDAITNIKKYSTLAWNFVKEKYFKLVPFGAELNEVLTEIW
QEIKELEKIDQVQIMVQKYYEVMAKVDWVADELQLEHRLHQVYGLVRNKFRNYAMNALET
ADMYREAKTKFVFDPEVGIIDLEQKLPMSWHAFNETPKFEEIPEYQVLAKAQSFFSETNS
SIVMKLYNMRTHLDPKTWLPPYYSRALLIDSRHYMTFDQRYVGLNLNFDELGTGRSTSQC
SYLLAHDFFKRNFTLLLEPASKSLAGQGLTRKLSFIANGQLIEIDLETDHISINGNPQPI
LPLKLGDVNIHRDLDVLSITSDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPY
DEYTMSSGVISNETQRFTDSWSLKQCRQNKLAPTQEVSKEVSDACSSFFRTGILATCSAV
LDPTPFYEMCMDLGMKSPPIRKGHPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLS
NGSYVPEGTFMELSGPEIPRSSDVVFIVEAKECNANLKTSKNIMTVVSSIEEQLQAAKLT
NNRYAVMAFGGVSPYDKARSVIYEHNEFTSKPEQLADYFGHINTGNGSSNDILMAISAAA
KLNFRPGVSKTFILLSCSKCAARDMRFDYTSILQYLLEEGVNLHILADTEFDFERSKKLR
HFFGLDSRLVYSKRFPEGDAETRNTTHIPKSNLGICTTLAVETQGSVFSARKLQPERKYP
IKRFATIFAKRVALSATPIQSQTCECSAHNTGVSYMACSPQALPEEKYDLDDYDSFNNWD
WGDEPESETNVTS
NT seq 13002 nt   +upstreamnt  +downstreamnt
atgggtggattgaagccacaggcggctatttggctgcttctgcttatcgcacacactcag
gcagtgagagaaaatccactcaaagatcctcggatttgcggacggcctcaatgtgattcg
aaaagtgctaagttcaattatggcgaacaactctacaaatatcaatacacggttgctgtg
cgcaccgagttcgccggatccggcgacaatagttctgacctcttgctgaagtccgacttg
gaaatcttcttcccaaagccctgcgagggctacttgaggatcaacgatgccaagctgtac
gatacgttggacgagctcaataacgacgagagcgattcctccgagaagaccaaagagtac
gactactatgacaatctggctaacgaagaatccgagtcgcaaaactatgataatatgcac
cctaagagctctgatttcaatgtggatcttaccaagaatcttctccgatttgctttccac
gacggcctcatcagcgaggtgtgtccgcaggagcaggagacaccatgggtgctcaacatc
aagaagggcatcctttcggccttccagaatacaatgatgcgtttcgacgtcgatgccaat
acaactgaaaccgatgtctccggtcaatgtcatgtgcagtatgcactggaagacactgac
agttcctatgtcttgatacgcaagaccaaggacatcaactcctgccgacagcgatatgcc
acccactccgttctccagactacgccttacacattccgcgatgacaagaccatttggcca
atccttaaatcccaaagttactgcaatctcaccattgataacaacgtttataaagaagtc
aagtgtctggagacacatcttctggtgcccttctccaatgccagctcaggtgccctgacc
accagtaccagtcggctgaagctcgacggggtggagtcttacagcgccggagagttctta
gaacaaaatcccgagctagtcgatagacgtgccactctggtatttgatcatacacctgcc
gtaaagccctcgcatgatgaaattaaggctgccagggaacttttggtggagatgtgtaga
gttggctttcccaatatccagcgtgagttcatcgatgtcttcaccaactttctgcagacc
tccaagagcctcgactacaagacactatccgtgctgctccagcggtctgctagtacctgt
gaacagggcagaaatcacctgttggaatcgcttcccttcattggtagcacggcctcatat
aaagtgatgcgtgatcagattatcaacgaaaaactgaccaagcaaatggctcacgactgg
atgaccgcattgtccttcatcacccggcccgacgaagagaccctggaaacattccattcg
atcctggaatacgccaagaatagactggacgcggaatacaccctgggagccactgcagtg
gtgcacagcttttgcaaacaccacgaagcgtgcgaggagaaccttcgagttcagcagatt
atcaatcttctggagaccgagtttctgaacttatacaacctgtttaagggagagcgtcgc
acccgtgagcgtatggtgatcttgctgaagggattaggtaacattggagtggtgtcatct
gcattcgccgaacagctacagtggattattcgtgaggacgaagcccctgtggatattcgc
ctacacggtatcttggctttccgaagggtggactgcgctcggcatcggagctacttcctg
gataactacggcaactatactttgaattcggaactgcgtatatacagctacttgcaggcc
atgaggtgtcctgactacatatcagttggggtcataaaatcgatcctagaacatgaggaa
atcaaccaggtgggctccttcgtgtggtcccatctgaccaacctggcgaaatcaaattcc
ccagttcgcatcgaagctcagggtttgctgcttaatgatgagctctcggaacgttttaaa
atggacatccgcaagttctcgaggaactacgaacacagtttattcttcgacgagtacaat
tttggaacaaccacggatgcgaatgttatctttggaaccgattcctacttgccacgcatt
gctagtgttaactttactgccgatctcttcggccagtcagttaacttctttgagttcacg
gcccgcgctgaaggattggaggagttggcggctaacgcttttggtcccaaaggacctttg
agcggtcagttgttgcgcaagaagctctccttcctcaatcgctggctgggcaatgaaagt
gccgaggaagacgataccctcgaaaatctgctgagtctggataatctgcgactgaagagg
aaggctcagcaacaagctcgtgcatccgaggaggaagaggatgaagattacgactttgag
gagtccttggaaagtaataagcgacaaaagcgagatgtcagtaccacacgtaagcaggag
atcgatcgcaacgttgacagtcttggttataagctgaagtacgactacaataatccacgg
gcacagtttggattacgggtctttggcaacgatctgcgctacttcaacgtagagtctttg
gtggaggtgatggccctggctgccaaattcaatcccttccagcaggcaaagaatatactt
tccggcaaggagtttacgtatacgaagtcccgggtatttctggatgcctcatatacagtg
cccctggcggtcggccttccattggcgattcatgcctttggagcttcctccatagacctt
cgtgttagtggcaacctggatgaaatggatccgcccaccgattggcactttgatgtcgaa
ggtcagtttaagccctcggtgtccgtggatgtgatcaccaccatgcagacggacatgttc
tgggaacaatccggcatcaaggtgaagagcaacctctactctaactccgagctggtggcc
aagcttaaggtgcgtggccgcaatctggtctcgttctcgtttgatcttccccgggacaaa
aacgagattttcagtgtgcgatccgagttgttggttcagaagcgggaggagcaactgccc
caggagggcattgctaagcgaagtgccaattccacatgcacctggccagttctcgatcag
gccatcggattgcagatgtgctcccactacagtgttccagatctgagcaatgccaccgaa
atttacccaagccttttgctggcaggaccacttaactttagcttgattctgaagaagtcg
gatctaagtgctaagaagtacgtgttcgagtacaagtgggatcagcaggaagaggacaac
aacttttcgctggtgtttaccactccgggctcaaaggttccccgggttctggttgcaaat
gtgaccaaggtgcccgatgccttcaatgcatccgtggcttttgtgaatggacctaatcgt
gtctccgctgggtgcagctatgatggaaacccggatttcagacgcttggatatctacttg
gatacgaatggaaatcgatcgttggaccttggaatggaactgcgaaggcaccaggatttc
actgcctggatctacaatcctcgtatgctgctggccattaatggtgtcaacattactggt
ctggctggcaccgtaaaagtaaacgagaagaatggtatcaagcaacatgatgtggatctc
tcatttgaaaccaaaaagctgcaggctgtgatcaagggcaacgtcgtccaaaccgagata
accacctcaactaacatgaccattaaatacaggttccaagcaaataagattgaggagatt
aactttgccggaaagctggttaataatggagataagagcaagacggagtatcgcggtaac
atgaagctccagacctcggcatatcccaagctaaacttcgcatcggaatccacgtggctt
agtcttcaaggccacaccgaaggaatgatcaattacaataatgcgccggattatgttaat
cccaactacaccagtttggttcgtttggtctttgctcgctcccaagctgacgacaccttc
ttggatgaaatgcaaacgcgagccagtctagaactgaagcttccaaggtcaaagattgac
taccgcattttagttaggcacaaagaacacatgaaaaacggaaccgagcacaatgtcatc
gttggtcttaagtacgctcctgagaaggagatcactggactgttttccgtccatttgcca
agacggaacctgtttgccattgatgcctacatgaacgtgaccgtaccggagttcaattcg
tgcacagccagtcttaaagtgaacgagaaagtcaccaaggattatatcatctttattaac
ggttcatggtttactggacactcagtcgcagtcaaggcaaactacaaggatcgcagctcg
cgggttcaggctcttcaccaccttaaaatgattgtggaaagtccgtccttcaatataacc
tccctcaacattatctatcgccgaaaacagttgttgatcttttatgatattcaagccaaa
tatgaccaagatccgtatggccttacaatacaatatgcttccaatgaccataatcgcaat
accaatgcggaggtgcgactgaaggtcaaggaacgtgactactggattaatgctaaattg
ttgtcagagcagcctaaactcctgcagctggaaattcacatggataaaatacgtgatgta
catattcaagttggcctgctaaatgtggacaagcgcaaggagctttctctagagctgaag
tgggatgctaatcgcgatcctagccagagactgggtctacttgccgaatacaataatcct
ggaacaaagcactacgatggaaatctgatgatcacctatccggagcgcaccattaacttt
ggctttaactcctttaccggaggacccaaatacttcggaaagctccacgcgtcctggagc
atcaacgaggtgatcgagttcgagtacgaagcgggtattctgcctggccatacactccat
aactgggtaaaagcagagctgcggacgcctttcaaaggctggcgagtcaacagccttgat
gctggcatttatagtctgcaaaacctgatcctagtcaactctacgctcttctgggcaggt
gatcagaagctgcaggtgggctacaagagcgactacgacgtcagcgatcaactaatgagt
tttgatgttcgcttcggcatcaatagcaccatccgggatattcccacgatcaatgtgagg
gtaaagcattggatggatgttaagaaggtggacacagagctctatcttggatacagtggg
cagaatgatacatttaacacctacagcatggactccagttgggagattgagaaaaaccaa
cgatacaataattattctggtttagtgcatctggtaagtccattcaagggctacgagaaa
ggtggtctggtggcccacttctcactgagcgatcaacgggtggtcagtggagcagcttcc
ctaaactttgatcttcgggagttcactttgacaatgaacggctatgtcaaaaagtttacg
gacaacatgctaaccgttaacatcaccactccgttggagaaattccgcaccatcaacgcc
cgctttggtctaaacgaaaagaaacgccatgccgtggcggaggtcagggctcccacggca
gctcttggagtggaggtcctggcggatgttaagaatctcctgaacttcgatgtcaagctg
agtgtggccacgccgatcgaaagtttccaacaggcggcaatatttgcactgtttaatccg
gagcatgttgacatgcgcgggctgtggaacaatgtcaccctgggattcactggcgtatgg
cacatgcagaatataaccgattttgagtactcctaccacgtattcaccccactggctggc
ttcgaagagaacggtttcattgttcagctactgaagaggaaggagtttgtctttcagttg
cacggcaagatgtccaactataagcttggtgtgaaaatcaatggaaaaccaaagtctgac
ttggtaaatcaactgggcagcaataaaatggaattggagatgctctacgacgcggacttc
aagccacttaatgctgagatggattacaagccagatgccgatgaggagtacttctcctac
ttcacggacttccaggtggacactcttgtgtggccaactattgtgggtaatgtggatatt
caggagatcatagatttctatctggttgtaggccatgtggaactgccacagggcaaggtg
gagttcaaggatcgcctccactaccctgactacataaatgtccacaatcttttgaccgtg
actacaccatttgcggtggccaagaatataaagtcaattgtggagtatcacgttgactta
cacttcaacgcgttctatgagcgcgtcaaatttgtagtcaacgatgacaaggacaacaca
caagagctgggctttgtgtttaattacaccgcactgcaggataatgttaagcccaaggct
catgatgtacagatcacgctcctcacaccctacgaaatgcttcacgaaatctacgttcac
ggacacctcgaactggatgagaatgcctataagggcaacatcagtgcggttacggcccac
acacatctttcgatggctgcctccatagagaacgaggacagcttcttggaaacttccgtg
ggcatcctgttggagacggacgctattccccactatggatgccaggtgtactttaagaaa
gacttctcagccgtggataaagccattgatattcgattcgaggtcaccgacaatggaaca
ctcaaccagcttcacattgccacggattggcacacggatccgtcttacattgttaacgca
aatggaaggattaaaaccaccatgctgccacttcagatggcgtccacttctgttctggtc
gtcaagggtcagaatccccagctcaatttcgatcttaacttattgagccagaatggccag
agcataggctacggagcgcgggccaacaagaaaaaagatgtcttcaacattgaggtgtgg
actccaatgaaaaacttccgaaacatttccatgcacggtactgcgattagaagcccccga
gattccggccgatatgatgtctcagggttcttgtacagaaatatggcaacatatggagtc
acaggagccgtccgcatgaccgatagtctgccaattgatgtcgttttaagggtacagccc
aaagctggcggtcgagatggtgtgattgaacttaacatccatgaggcgggaccgaagaag
attcgcttttcttttagcgccattgaggatggcaaaatgtgccagatgtcaggaggttac
agtgtcagcgagaccaacggagctatggatttctcagttctagtggagagcacggagcca
gaaatcgcacgcattaatttctacggcaatcttagtcccaactccgagggttcccttgtg
ggagacttgaacttggagaccccatggaaggagctcggaatcgatacggtgcacttgcac
tcggacgtcggttttgtgaatgaaagaggccacatagtgggcgagtataagatcggtcag
tatataggccgagggagctgcctgtggtcttggattctagccgaggatatgcagctggta
ctggaaaactacctggagagaccaaatgctaagccacgaattgtccacgctagtgccaag
taccagaacccgggacaaacatacgcccagttgcaggcgggtggacgactgagcgtcgat
tccaaatggaatctcgacgtaaatggtagtgcagagtataagtcagttgatgatttcaag
ttcagagttatcaccgcgttgcctttgcctgttggagatcgccaccagctgagtgccagc
tatcagggcaacgtgatcagcaagcagttcaacaatcctgattttgtccttgagaccagc
tacgagagtgtggaagcacaaaataagcttttgtctcgaatttcttataaaaatgccacc
aataaccaaaagggcttgggccatgtcgagtggggaaagattcaaaacttgtctgtagtg
gagggtgactttgagttgctccacaagcagggagcccaaaaagagttctctgctaggatg
atcacgcccaaatttaagaatgaacacacatttgcccttacgggaagttatgacttggaa
aagtcgggtcaccacaacgtggtgggcgccttggactatcctgccagtcgtcgcattacc
gatctggatgtgtcctttagttcgctaagcaacatgcatggaatcttcaacagcacactg
ccaaccttcctcaatgtcagttggctaaagacagactttaactttaccaccaacaatgga
aagagctaccgctactgtcgttgcttctggccccaggattctgcctacttcaagttgaac
agcaactatgatagcgacagcaacaactttaaccacaatctcaatggcaatgtggaaata
gaagttccattggcaacacggcatcgagcggatatggtgtatggcttgcaaaagcgtcgc
aatcaggatgcaggaaatgtcaaggtcgtctacaatgagaagcaagtgctcgatggcaag
tacaagcgggtggaacaggcgaaggccccaatatataaggagacaacggacatctcgctg
gagaacgaagtgaaaccgctgggaattcactttgtcagcaccagggatgccagcgacccc
gcaggaacccaggacgttaagcacatcgaggtctacgagctgaggaacacgcagaacttc
aatctcaccggtgagctgcactcaagggccactctcaaggcgcaggacttcaaggtggtg
gccattcatccgaatcgtgccgtagtgcttagcactaagtacgaggacgtcagccccgaa
gttgtcaggcatcactcaaagttggagttgtcggaaacagcatggattggatacaactta
gagctgggtaatttcagcaaggttggcaatgagtcccagagctttgccctggaaattttc
tatccgaagcgcaatctctcctcttcaggacagtactacatgacggacacaaactttaat
tccgacctgtctttccaatggctgggcggcaactatgaccaacagcccaagactatacac
agcaatctgcaatggaaagcggaacccctgcatcgtggagatcgggaacatcgcaccatc
gcgctgacggtggcacatcccctcctggagaaggacataaactgcaaggcgacgtactac
cgtgggctgcgtgatctgttaaggacacacttgaccatcgactactcggaaagtcctgac
caacttattgagcttggtgctcagctgacggatagatacagtgaactgggccacaccaac
tacaccttccacgtgtacggcaaacatattgcttccgaactggatgtccagttaaatgga
actttggcggccaggaactcttactataagacggagtcgacagcccactacaagcgtgac
atcttcccggcgagatatggtaaattcctggctctgctcgatgtgaataagcgggaactg
gaatacgaacgtcagtcgccattccacgcagtgcgactacacctgctgccaaccattcgg
tatccgatttacggcttgaatgccacaatttgggatactcctgatacaaaccactcaggt
tacatatacattgacatgttggagcgctatgctcgcatggatttcaacttgacggaggat
gccagccagaatcttcaaatggtcggttacattccggacacacgcagtgcattcctggac
atttggcgcaactacgaggagatacgtgtgatcgatgtcagttcgtatctgaagatgaat
cactcacgtctaatcactggccgcttccactggcgtccatctatccggcaggaagttcgc
gaaaaaattcaagccgtgggcaaatcggtgtacagctcattctcggaaggtattgatttt
tggattaagtctatctacacggaaaccaccgaatccatgggcgtggtgtggaacacagcc
aagcagtacaatagggatttcatcgacgatattggccagctgagcgttttggaggaggat
ctcgctgatctgcgattgtttgtaaatcagtcgtatgaggcaaatgatttctatatcaag
aacgtagtcaatttcacgctaactatcctggatgaactcgccatcagagatcacatcgag
tcactgcccaagatcttctctgaactgtggcaggcaatgggggattctggaaaggcttta
cggaacagcattgtgtggctaatcgataccattaaaaccacgtacaataatcttctggat
gctgtgtcccgattcttccatggcgagagtctcgtctatatatctgctctgctagagaag
ggcatcgcaaagtacgacagttttattaaagatctgcacatcaagtttataaaatacatt
gaaaatctttggcacaagacttggacattggcggagaaccactggaaggcagtcctaaag
cgattcgagcctcatcttttcaagatgattagctttatagagactacagcctggaacctc
agcaaggaggtgtttgatttcatatacaagcgcaccaatgagctggcggagtctccgtac
ttcaacaaggtctccagttttacggctgatgcagagcgactttaccgggacttcaaggct
aacgatgccatcaccaacattaagaagtattcaacgctagcctggaattttgttaaggag
aagtacttcaaactggtacctttcggcgctgagttgaacgaggtccttactgaaatctgg
caggaaatcaaagaacttgagaaaattgatcaggtgcagatcatggtgcagaagtactat
gaagtcatggccaaggtcgattgggtggcagacgaactgcaactggaacaccgcctgcac
caggtctacggtctggtgaggaataagttccgtaactacgccatgaatgccttagaaaca
gccgacatgtatagggaggccaagaccaagttcgtctttgatccggaagtgggcattatt
gaccttgaacagaagctacccatgtcctggcatgctttcaacgagacgcccaagttcgag
gagattcccgagtaccaggtgctcgccaaggcgcagagcttctttagtgaaaccaactca
tcgatcgtcatgaagctttataacatgcgcacccatctggatcccaagacctggctgcca
ccgtactactctcgcgccttgctgattgactcgcgtcactacatgaccttcgatcagcgt
tatgtgggtctgaatcttaactttgacgagttaggaactgggcgttccacttcccaatgc
agctatctgctagcccacgatttcttcaaacgaaacttcaccttgcttttggaaccagcg
agcaaatcgctggctggccaaggactaacacgcaagttgagctttattgcgaatggtcaa
ctgattgaaatcgacctcgaaacggatcacataagcattaatggcaatcctcaacccatc
ctacctcttaaactcggagatgtgaacatccatcgtgatctggacgtactctccatcacc
tcggataccgagtttagtctgcactgcaatgttcagtttgatctctgttggttcgaggtg
agtggatggtactttggcaggacagcgggattactgggaaccctgaacaacgaaccctac
gacgagtacaccatgtccagtggcgtgatctccaatgagacgcagcggttcacggattcg
tggagcctgaagcagtgcaggcagaataagctggctccgacccaagaggtcagcaaggag
gtcagtgatgcctgtagcagctttttccgcaccggtatactggccacctgtagtgcagtc
ctcgatccaactcctttctacgaaatgtgtatggatttgggcatgaagtcgccgccaatt
cgaaagggacacccggcggtgaaaggagcctgtgcagcagctttggcttacattgaggcc
tgtacggctctaaaggttcccatgcgggtgccttctcagtgtgtattctgccagctctcg
aatggctcatacgtgccagagggtacattcatggagctctcagggcctgagattccaagg
agcagcgatgtcgtcttcatcgttgaagctaaggaatgcaatgccaatctcaaaacgtcc
aagaacatcatgacagtggtgagcagcatagaagagcagctccaggccgctaagctaacg
aacaatcggtacgctgtaatggccttcggaggagtttctccatatgacaaagccaggagt
gtcatatacgaacacaacgaattcacttccaagccggaacagctggcggactactttggc
cacatcaacaccggaaatggcagcagcaacgatatcctaatggccatttccgcggctgcc
aagctgaacttccgtccgggcgtatcgaagaccttcatcctgctctcgtgcagtaaatgt
gcggccagggatatgcgcttcgactacacatccatcctgcaatatttactggaggagggc
gtaaacctccacatcctggccgacacggagttcgactttgagcgtagcaaaaagctgcgt
cacttctttggcttggatagcaggttggtctactcaaagcggttccccgaaggtgatgcg
gagacccgcaacacgacccacatcccgaagagcaatctgggaatctgtacaacgctagcg
gtggagacacagggatctgtgttcagtgcccgcaagctgcagccggagagaaagtatccg
atcaagcgattcgccacgattttcgccaagcgggtcgccctcagtgccacgcccatccag
agccagacctgcgagtgctccgcccacaacacgggcgtctcctacatggcctgctcgcca
caggctctgccagaggagaagtacgatctggacgactatgactccttcaataactgggac
tggggagacgagccggagagcgagacaaatgtaacgtcgtag

DBGET integrated database retrieval system