KEGG   Drosophila simulans: Dsimw501_GD23775Help
Entry
Dsimw501_GD23775  CDS       T01065                                 

Gene name
Dsim_GD23775
Definition
(RefSeq) uncharacterized protein
  KO
K10865  double-strand break repair protein MRE11
Organism
dsi  Drosophila simulans
Pathway
dsi03440  Homologous recombination
dsi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Dsimw501_GD23775 (Dsim_GD23775)
   03450 Non-homologous end-joining
    Dsimw501_GD23775 (Dsim_GD23775)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dsi03032]
    Dsimw501_GD23775 (Dsim_GD23775)
   03400 DNA repair and recombination proteins [BR:dsi03400]
    Dsimw501_GD23775 (Dsim_GD23775)
DNA replication proteins [BR:dsi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     Dsimw501_GD23775 (Dsim_GD23775)
DNA repair and recombination proteins [BR:dsi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     Dsimw501_GD23775 (Dsim_GD23775)
    BRCA1-C complex
     Dsimw501_GD23775 (Dsim_GD23775)
   NHEJ (non-homologous end-joining)
    MRX complex
     Dsimw501_GD23775 (Dsim_GD23775)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 6731970
NCBI-ProteinID: XP_002079104
FlyBase: FBgn0195147
UniProt: B4QAD4
LinkDB All DBs
Position
2L
AA seq 620 aa AA seqDB search
MNGTTTAEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLG
GDLFHDAVPSQNALHKCIELLRRYTFGDRPVSLEILSDQGQCFHNAVNQSVNYEDPNLNI
AIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLTQVEISPVLMRKGESQLAL
YGLSHIHDGRLARLIKDFKVKFNCPENVANGEDGNESKEEEDWFHLLVVHQNRADRGPKN
YLPEDLLPSFLHLVIWGHEHDCRIEPEENAKKRFYVSQPGSSVPTSLSEGEAKKKHVGLL
EIYKGKFKLKPLPLETVRPFVFESVVLADHADELGLVEGDASTKVFKFAQERVEAMIERA
VAQHTGHPKQPTLPLIRLRLLYTDESCMFNAIRFGEMFSTRVANVQDVVQFSKVVKRTKT
EAVNLDKEALRRALEADNATRVEELVDRYFEEAKSNKPLKLFHSKALAEMTYRLLEQRDA
DAAENIVKFYKEKAVDHLMEAMPNDENIDEELERFRALYKHGDLLKMLETQGLKVKKEEK
STSVLGSEANASTVPATGRGAARGRGTARTRAGATAGTRGKGQLDVTVSSTRTSGRQQTL
LSSVMGSRNTASYVISDDSD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcaccacgacagcagaacaggatgcggacaacgtgattcgcatcctggtggct
accgacaaccacctgggctatggcgaaaaagacgcggtccgcggcgaggacagtttcaca
gccttcgaggagatcctggaactagcggtgtccgaggatgtggacatgattctgctggga
ggcgacctcttccacgatgcggtgcccagccagaatgcgctacacaaatgcattgaactc
ctgcggcgctacaccttcggtgatcgtcctgtttccctggagattctcagcgaccagggg
cagtgcttccacaatgccgttaaccagtcagtgaactacgaggatcccaatctgaacatt
gccattccagtattctccattcacggcaatcacgacgatcccagtggcttcggtcgtttg
agttctctggatttgctgagcacctcgggactggttaactattttggtcggtggaccgat
ctaacccaggtggagatcagccccgtgctgatgcgcaagggagagagccaactggccctg
tacggacttagccacatccacgacggccgactggcaaggcttatcaaggattttaaggtg
aagtttaactgtcccgagaatgttgctaatggcgaagacggtaatgagtccaaagaggag
gaggattggttccatctgttggtggtacatcaaaaccgcgccgatcggggaccaaagaac
tacctaccggaggacctgttgccatcgtttttgcatctggtgatctggggtcacgaacac
gattgtcgcatcgagccagaggagaatgccaaaaagcgcttctatgtctctcagccgggc
tcctcggtgcccacctccttgtccgagggtgaggccaagaagaagcacgtcggcctgctc
gagatctacaaaggaaaattcaagcttaagccgcttccgctggagactgtgcggcccttc
gtctttgaatccgtcgtactggccgaccatgccgacgaattaggacttgtcgaaggtgat
gcctctaccaaggtttttaaattcgcccaggaacgagtggaggctatgattgagcgggcg
gtagcccaacacaccggtcatcctaagcagccaacgcttccgctcattcggttgcgtctc
ctctacaccgatgagtcctgcatgtttaatgcgattcggtttggagagatgtttagcact
cgggtggccaacgttcaggatgtggtgcagttcagcaaggtggttaagcgtaccaaaacg
gaggctgtcaatctggacaaagaggcattgcgacgtgcactggaagcggataatgccact
cgcgtggaggagttagtcgatcgatatttcgaagaggccaagtcgaataaacctctcaag
ttattccactcaaaggctcttgctgagatgacctatcgactgttggagcaaagggatgcc
gatgcagcagaaaatattgtcaagttctataaggaaaaggcagttgatcacctgatggaa
gcaatgcccaacgacgaaaacatcgacgaggagcttgagcgatttagggcgctttacaag
cacggggatctactgaaaatgctcgaaacacagggcttgaaggtgaagaaagaagaaaag
tccacgtctgtgttgggtagcgaagcgaacgcctccactgtccccgcgacgggacgggga
gctgctaggggtcgtggaacggctcgaactcgagcaggtgccacagctggcacacgagga
aagggccagctagatgtgacagtcagtagtacgcgaacttccggcaggcaacaaacgctc
cttagtagcgttatgggctctcgtaatactgccagctatgttatatcggatgattccgat
tga

DBGET integrated database retrieval system