KEGG   Drosophila simulans: Dsimw501_GD23794Help
Entry
Dsimw501_GD23794  CDS       T01065                                 

Gene name
Dsim_Mal-B2
Definition
(RefSeq) maltase B2, isoform A
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dsi  Drosophila simulans
Pathway
dsi00052  Galactose metabolism
dsi00500  Starch and sucrose metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dsimw501_GD23794 (Dsim_Mal-B2)
   00500 Starch and sucrose metabolism
    Dsimw501_GD23794 (Dsim_Mal-B2)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dsimw501_GD23794 (Dsim_Mal-B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 6732019
NCBI-ProteinID: XP_002079152
FlyBase: FBgn0195164
UniProt: B4Q3A6
LinkDB All DBs
Position
2L
AA seq 583 aa AA seqDB search
MRAPLIQILLFSLLNSGSSMAGLVKSDTEDFIDWWQHTVFYQIYPRSFMDSNGDGIGDLK
GITSKLRYLADTGITATWLSPIFQSPMVDFGYDISDYKAIQPEYGTMADFEELIDTAFEL
GIKVVLDFVPNHSSDQHEWFKKSAAREPGYEDFYVWHDGIVQENGTRVPPNNWPSVFYGS
AWKWHEGREQYYLHQFTKEQPDLNYRNPKVVQAMDDVLLFWLNKGVAGFRIDAVNHLFED
ESLKDEPLSGKTGDSLSYDYTEHIYSRDLPEVLEMIHHWRQLLDDFSAKHPERPTRIMMT
EAYAGLTQLADYYEDSNGVRGSHLPFNFHFITDVKGDSDARDYVYNVEKWLIYMPRGHAA
NWVMGNHDNPRVASRFGPASVDAMNMLLLTLPGVAVTYNGEELGMVDYRELSWEDTVDPP
ALNVGEELYQEVSRDPVRTPFQWSNETNAGFSTATKTWLPVHPNYLELNLEAQKAANRSH
YHVYKDLLELRKSAIMRVGRFNIEPLTRWVFAFKRSYPNFESIITVINVSDKEQLVDLSE
FLSQPKKLVVEVSGVDSKYQPGQSLAASALLLAAREGLVCRLV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctccactcatccaaatccttctttttagtctgctgaactccggctccagtatg
gccggtctggtgaagagcgacacggaggactttatcgactggtggcaacacacggtcttc
tatcagatctacccaaggtccttcatggacagcaatggcgatggtatcggcgatctgaag
ggaatcacctccaagctgcgctatctggcggacactggcatcacggccacctggttgagt
cccatttttcagtcgcccatggttgactttggctatgatatatcggattacaaggcaatc
cagccggagtatggcaccatggcggatttcgaggagctgatcgacacggccttcgagctg
ggcatcaaggttgttctggactttgtgccgaatcacagctcggatcagcatgagtggttc
aagaagtctgcggccagggagccgggttacgaggatttctatgtgtggcacgatggcatc
gtccaggagaatggcactcgagtgccacccaacaactggccatcggtgttttacggatcc
gcctggaagtggcacgaaggtcgtgagcagtactacctgcaccagttcaccaaggagcag
ccggacttgaactatcgtaatcccaaagtggttcaggccatggatgatgtgttgcttttc
tggctcaacaagggcgtagctggtttccgcatcgatgcagtgaatcatttgttcgaggac
gaatctcttaaagatgagccattgagtggcaaaacaggggattcactctcctatgactac
accgagcacatctactccagggatctgccagaagtcttggaaatgattcatcactggcgg
cagctgctggatgactttagtgccaagcaccccgaaagacccacacgcatcatgatgacg
gaggcgtacgcaggactcacccagctggcggactactacgaggattccaacggggttcgg
ggctcccatctgcccttcaactttcactttatcacggatgtcaaaggcgactcggatgcg
cgtgactatgtctacaacgtggagaagtggctgatctacatgccacgcgggcacgcggcc
aactgggtcatgggcaaccacgacaacccccgggtcgcctctcgattcggtccagccagt
gtggacgccatgaacatgctgctgctcacccttcccggtgtcgccgtcacttataatggc
gaggagctgggcatggtggactaccgcgaactgagctgggaggacacggtggatccaccg
gccttaaatgttggagaggagctctaccaggaggtctcccgggacccagtccgaacaccg
ttccagtggagtaacgagaccaatgccggtttttccaccgccaccaaaacctggctgcct
gtccacccaaactacctcgagctcaacctggaggcccagaaggcggccaacaggagccat
taccacgtctacaaggacctgcttgagctgcgaaaatcggccattatgcgtgtgggtcga
ttcaatattgaaccccttactcgttgggtgtttgcctttaagcggtcctatcccaatttt
gagtcgataattaccgtgataaatgtgagcgacaaggagcagttggtggatctctcagag
tttctcagccagcccaagaaactggtggttgaagtttccggcgtggattccaaatatcaa
cctggtcaatccctcgccgcaagtgcattgctcctggccgcccgtgagggtctcgtctgt
cggctggtctag

DBGET integrated database retrieval system