KEGG   Drosophila simulans: Dsimw501_GD23939Help
Entry
Dsimw501_GD23939  CDS       T01065                                 

Gene name
Dsim_GD23939
Definition
(RefSeq) GD23939 gene product from transcript GD23939-RB
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dsi01002]
    Dsimw501_GD23939 (Dsim_GD23939)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD23939 (Dsim_GD23939)
   04090 CD molecules [BR:dsi04090]
    Dsimw501_GD23939 (Dsim_GD23939)
Enzymes [BR:dsi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Dsimw501_GD23939 (Dsim_GD23939)
Peptidases [BR:dsi01002]
 Metallo Peptidases
  Family M2
   Dsimw501_GD23939 (Dsim_GD23939)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD23939 (Dsim_GD23939)
CD molecules [BR:dsi04090]
 Proteins
  Dsimw501_GD23939 (Dsim_GD23939)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 6732278
NCBI-ProteinID: XP_016024942
UniProt: A0A0J9R277
LinkDB All DBs
Position
2L
AA seq 844 aa AA seqDB search
MHSVSLFGCLCLSLSLTLSSASPQLNLPTPQPEVFYNGYTPNVATTPAQLRADRDRDQRY
GPPYSDAGGGGNTDDGLDDFRFGQTDDERMRIGYGYPTPRVNFSDSPFSGARFSNHNYGP
ISSTTERNYGNDANPNGRYSDVPYSSQGERNFNPNDQYNYNNNPNVEFVGINNRNRFENP
FLSNQDRFNLNQGYLERQRYQQDRRYQQELEKLRILLVESDQKGSLECTANVAAQWNFET
NVNDFTQTEALNAQQRYVEFQRITAEQSKRINKDLIFDRRLYRQLMLQSEVGPNALPLDV
LDRYNRLLNEMLFLYNSAGICAYQQPFQCDLHYIPQLKDIMAKSRDWDELQHTWVEYHRK
AGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYWYLAYESGNFRQDMDIVWEQIRPLYEGLH
AYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLIDVTPRMVEQ
GYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLDRRVLCEPSAWDFCNRHDFRVKI
CTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQAVGDAIGLSVSTPRHLQT
LGLLQRSLDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNANKRTMNCHYWNLR
EKYSGIKPPVLRSEKDFDPGAKYHIPANIPYIKYFFSTVLQFQIYRGLCRESGQYVPGDP
RKPLHQCDIYRQPAAGNILKTLMSKGASQPWQEVLEETLREGRLDGTALREYFAPLEEWL
RQENLRTNEYVGWNYDGDYCKRSIETAGLQIFGGYYNGATGQKSAPYLYPLIILIYLYFS
LRLL
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtgtttcgctttttggctgtctttgccttagccttagcctgactttgagttcg
gccagtccccagctgaatctgcccacccctcagcctgaggtcttctacaatggatacacc
ccgaatgtggccaccactccggcccaacttcgagcggatcgggatcgcgatcagcgctac
ggaccaccttactccgatgcaggaggaggtggcaacaccgacgacggactcgacgacttt
aggtttggccagacagatgacgaacggatgaggatcggctatggctatcccacgccccgc
gtgaactttagtgattcacccttcagtggggctaggttttccaatcacaactacggaccc
atttccagtaccaccgaacgtaactatggcaacgatgccaatcccaatggacgctattcg
gatgtgccctactcctcccaaggagagcgtaacttcaatcccaacgatcagtacaactac
aataataatccaaatgtggaattcgtgggcatcaacaatcgcaatcggttcgagaatccc
ttcctttcgaaccaggatcgtttcaatctaaatcagggctacttggaacgtcagcgatat
cagcaggatcgtcgctatcagcaggagttggagaagctgcgcatcctgctggtggagtcg
gatcagaagggatcactggagtgcaccgccaatgtggctgcccagtggaacttcgagacg
aacgtgaatgattttacccaaacggaagcgctaaatgctcaacagcggtatgtggagttc
cagcgcatcactgccgagcaatccaagcgaataaacaaagatctcatcttcgaccgtcgc
ctctacaggcaactgatgctccagtcggaagtgggacccaatgctctgcccctggatgta
ttggataggtacaatcgcctgctcaatgagatgctgttcctgtacaacagcgccggaatc
tgtgcctatcagcagccctttcagtgcgatcttcactacataccccagctgaaggacatc
atggccaagagcagggattgggatgagctgcagcacacttgggtggaataccacaggaag
gcgggacgcggaatgcgggatagttatgagcagttgatcgatgtgatgcaggaggtggcc
tacgtaaacaatgtcaccaatggcggggagtactggtatctggcctacgagtcgggtaac
ttccgccaggatatggacattgtttgggaacagattaggcctctttacgaaggattgcat
gcatatgtgcgccgcaagcttagggattactatggtccagatcggataaaccgcatagca
cccattccctcgcacattctgggcaatatgtacggtcagtcgtggtccaatgtgctggac
attttgataccctatccaggccggaagttgatcgacgtcacgccgagaatggtggaacag
ggctacacaccccaactgatgttccagctggccgaggagttcttcacctccattaacatg
tccgcggtgggtccggagttctatcgcaactccatcttcgaacagcccctggatcggagg
gtactatgtgaaccatccgcctgggacttttgcaatcgtcacgatttccgcgttaaaatc
tgtacggatatcaatcaacgaagtttgattagtgtgcaccatgagatggcgcacattcag
tacttcctgcagtatcgtcatctgccgaagatcttcagaaatggagcgaatccggcattt
caccaggcggtgggcgatgccattggcctgtccgtatccactccaaggcatttacagact
ctgggactactgcaaagatccctcgatgagtccagctatgatattaactatttgttcacc
atggccattgacaaggtggcatttttacctttcgcattatctttggacaactggcgttat
gatgtctttagtggcaatgcgaataagcgaacaatgaactgtcactactggaatttacga
gaaaagtattccggtataaagcccccagttttgcgatcagaaaaggactttgacccggga
gccaagtaccatataccagcaaatattccctatatcaaatactttttctccacggttctg
cagttccagatctatcgaggcctgtgccgcgagtccggccagtatgttccaggtgatcct
aggaagccgctccaccaatgcgacatttaccgccagccagccgctggaaatatcctcaaa
accctgatgtccaagggagcctcccagccatggcaagaggtccttgaggaaaccctgagg
gaaggtcgcttggatggcaccgctctgcgtgagtacttcgctccactggaggaatggctg
cgccaggagaatctgcggacgaacgagtatgtgggctggaactacgatggtgactactgc
aagaggagcatcgaaactgctggcttgcagatctttggaggatattacaatggggcgacg
ggacaaaagtcagcgccatatttatacccactgatcatactgatttacctttacttcagc
ctacgtttattatga

DBGET integrated database retrieval system