KEGG   Drosophila simulans: Dsimw501_GD24777Help
Entry
Dsimw501_GD24777  CDS       T01065                                 

Gene name
Dsim_GD24777
Definition
(RefSeq) uncharacterized protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dsi  Drosophila simulans
Pathway
dsi00010  Glycolysis / Gluconeogenesis
dsi00051  Fructose and mannose metabolism
dsi00052  Galactose metabolism
dsi00500  Starch and sucrose metabolism
dsi00520  Amino sugar and nucleotide sugar metabolism
dsi01100  Metabolic pathways
dsi01200  Carbon metabolism
Module
dsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dsi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsimw501_GD24777 (Dsim_GD24777)
   00051 Fructose and mannose metabolism
    Dsimw501_GD24777 (Dsim_GD24777)
   00052 Galactose metabolism
    Dsimw501_GD24777 (Dsim_GD24777)
   00500 Starch and sucrose metabolism
    Dsimw501_GD24777 (Dsim_GD24777)
   00520 Amino sugar and nucleotide sugar metabolism
    Dsimw501_GD24777 (Dsim_GD24777)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dsimw501_GD24777 (Dsim_GD24777)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD24777 (Dsim_GD24777)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dsimw501_GD24777 (Dsim_GD24777)
Membrane trafficking [BR:dsi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dsimw501_GD24777 (Dsim_GD24777)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 27206589
NCBI-ProteinID: XP_016038690
FlyBase: FBgn0196098
LinkDB All DBs
Position
X
AA seq 541 aa AA seqDB search
MDRELNGAMKSVSINSAQLNGHNNGGGLDETDRVGVAQGAALSATEKITTTTAAATKSAT
ATTNATTATATTTNLTTHSPQQIALLSAAEKSKMVHELCQQLLLTDEQVQELCYRILHEL
RRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENNDFQMES
RIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLE
TWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLI
VGTGANACYMERVEEAELFAAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSI
NPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADE
PGNFTNCRLVLEELGLTNATDGDCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTV
GVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAVACREDILNGK
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcgggagctgaacggggcgatgaagagcgtgtccataaatagcgcccaactgaat
ggtcacaataacggtggcgggctagatgaaacggaccgcgtgggcgtggcacagggggcg
gcactgagtgcaacagagaaaataacaacaacgacggcggcagctacaaaatcagcgaca
gcgaccacaaatgcaaccacagcaacagccacaaccacaaatcttacaactcacagcccg
cagcaaattgcactcttatccgctgcagagaaaagtaagatggtgcacgagttatgtcag
cagctgcttctaacggacgaacaggtgcaggagctgtgctaccgcatcctgcacgagctg
cgccgcggcctggccaaggatacgcatcccaaggcgaatgtcaagtgcttcgtaacatat
gtgcaggatctacccaatggcaatgagcgtggcaagttcctggccttggatcttggtggc
accaacttccgggtgctgctcatccacctgcaggagaacaacgatttccaaatggagtcc
cgcatctatgccataccgcagcacattatgattggatcgggtacgcagctattcgatcac
atcgccgaatgtctgtccaactttatggccgagcacaatgtgtacaaggagcgtttgcca
ctcggtttcaccttctcgttcccgctgcgccaattgggtctgaccaagggcctgctggag
acctggaccaagggcttcaactgcgccggcgtcgtcaacgaggatgttgtccagctgctg
aaggatgccatcgcacggcgcggcgatgtccagatcgatgtgtgtgccatactcaatgac
accactggcacgctgatgagctgcgcctggaagaatcacaactgcaagatcggtctgatt
gtcggcaccggtgcaaatgcctgctatatggagcgggtggaggaggcggagctcttcgcc
gccgaggatccacgcaagaagcacgtcctgatcaacacggaatggggcgcattcggcgac
aatggcgcactggactttgtgcgcaccgaattcgatcgagacatcgatgtgcacagcatc
aatccgggcaagcagacgttcgagaagatgatatcgggcatgtatatgggcgagctggtg
cgtctggtgctggtgaagatgacccaggcgggtatactgttcaatggacaggattccgaa
gtgctgaacacccgcggactgttctttaccaagtatgtgagcgaaattgaagcggacgag
ccaggcaacttcaccaattgccgcctggtgctggaggagctcggtctgaccaatgccacc
gacggggactgcgccaatgtacggtacatctgcgagtgcgtctcgaaacgggctgcccac
ctggtgtccgccggcattgccacgctgatcaacaaaatggacgagccaacggtgacggtg
ggcgtcgatggcagtgtgtaccgcttccatcccaagttccataacctgatggtcgagaag
atctcgcagctgatcaagccgggcatcaccttcgatctgatgctgtccgaggacggttcc
ggtcgtggagctgccctggtggcagccgtcgcctgtcgcgaggacatactcaatggcaag
aagtag

DBGET integrated database retrieval system