KEGG   Drosophila simulans: Dsimw501_GD25325Help
Entry
Dsimw501_GD25325  CDS       T01065                                 

Gene name
Dsim_GD25325
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dsi  Drosophila simulans
Pathway
dsi00020  Citrate cycle (TCA cycle)
dsi00190  Oxidative phosphorylation
dsi01100  Metabolic pathways
dsi01200  Carbon metabolism
Module
dsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dsi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsimw501_GD25325 (Dsim_GD25325)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dsimw501_GD25325 (Dsim_GD25325)
Enzymes [BR:dsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dsimw501_GD25325 (Dsim_GD25325)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like TBK1_CCD1
Motif
Other DBs
NCBI-GeneID: 6735252
NCBI-ProteinID: XP_016028577
FlyBase: FBgn0196623
UniProt: A0A0J9RGM7
LinkDB All DBs
Position
2R
AA seq 661 aa AA seqDB search
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPDKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
IDKDGKDVIVPGLYAAGEAASSSVHGANRLGANSLLDLVVFGRACAKTIAELNKPGAPAP
TLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEI
YKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVRED
EYDFSKPLEGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDNEVSTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaatcatgcgtgtgccatcgattttggccaaaaatgcagtcgcctccatgcaa
cgtgccgcagccgttggagtgcagcgcagttaccacatcacacacggccgccagcaggcc
tcggcggcgaatccggacaagatatcgaagcagtacccggtggtggatcacgcctacgat
gcgatcgtcgtgggagcaggaggagccggcttgcgggcggcttttggcctggtggctgag
ggattccgcacggcggtgatcaccaagctgttccccacccgctcgcacacgatcgccgcc
cagggcggtatcaatgcagctctgggcaacatggaggaggacgactggaagtggcacatg
tacgatacggtcaagggctccgattggctgggcgaccaggatgccatccactacatgacg
cgcgaggcgcccaaggctgtcatcgagctggagaactacggcatgcccttctcgcgtacc
caggacggaaagatctaccagcgcgccttcggtggacagagtctgaagttcggcaagggc
ggtcaggcccatcgctgctgtgctgtggctgatcgtactggtcactcgctgctgcacacg
ctctacggtcaatcgctgagctacgactgcaactactttgtggagtactttgccctggat
ctgatcttcgaggacggcgagtgccgtggtgtgctggccctgaacctggaggatggcaca
ctgcaccgattccgcgctaagaacacggtcattgccaccggcggatatggacgcgccttc
ttctcctgcacatcggcgcacacatgtaccggtgacggtaccgccatggttgcccgccag
ggactgccctctcaggatctggagttcgtgcagttccatcctactggcatctacggcgcc
ggctgtctgatcaccgagggctgccgcggtgagggtggttacctgatcaacggtaatggc
gagcgcttcatggagcgctatgctcctgtggccaaggatctggcctcccgcgacgtcgtc
tcgcggtcgatgaccatcgagatcatggagggtcgtggcgctggacccgacaaggatcac
gtgtacctgcaactgcaccacttgccgcccaagcagctcgctgagcgtctgcctggcatc
tccgagaccgccatgatcttcgccggtgttgatgtgacccgtgagcccatccctgtgttg
cccaccgtacattacaacatgggcggtgtgccgaccaactatcgcggccaagtaatcacc
attgacaaggatggcaaggatgtgattgtgccgggactgtatgccgctggtgaggctgct
tccagctcggtgcatggtgccaaccgtctgggtgccaactctctgctggatctggtggtc
ttcggacgtgcgtgcgccaagaccattgccgagctgaataagcctggtgcaccggcgccc
acccttaaggagaacgctggcgaggcctctgttgctaacctcgataagctgcgccatgcc
aacggccagatcaccaccgccgatctgcgtctgaagatgcagaagaccatgcagcatcat
gctgctgtgttccgcgatggtcccatcctgcaggacggtgtgaacaagatgaaggagatc
tacaagcagtttaaggacatcaaggttgtcgataggtcgcttatctggaactctgatctg
gtggagacgctggagctgcagaacctgttggccaatgcccagatgactattgtgagcgcc
gaggcgcgcaaggaatcgcgaggtgcccacgcccgtgaggacttcaaggttcgcgaggat
gaatacgatttcagcaagcccctcgagggtcagcagaagaagcccatggaccagcattgg
cgcaagcacacgctctcgtgggtgtgcaatgacaacggagacattacgctggactacaga
aacgtgatcgataccacgctggacaacgaagtctctactgttccaccagcgattcgctcc
tattaa

DBGET integrated database retrieval system