KEGG   Drosophila simulans: Dsimw501_GD28052
Entry
Dsimw501_GD28052  CDS       T01065                                 

Gene name
Dsim_GD28052
Definition
(RefSeq) uncharacterized protein
  KO
K16679  wengen
Organism
dsi  Drosophila simulans
Pathway
dsi04013  MAPK signaling pathway - fly
dsi04214  Apoptosis - fly
dsi04215  Apoptosis - multiple species
dsi04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dsimw501_GD28052 (Dsim_GD28052)
   04391 Hippo signaling pathway - fly
    Dsimw501_GD28052 (Dsim_GD28052)
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dsimw501_GD28052 (Dsim_GD28052)
   04215 Apoptosis - multiple species
    Dsimw501_GD28052 (Dsim_GD28052)
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 27207901
NCBI-ProteinID: XP_016022754
FlyBase: FBgn0269342
LinkDB
Position
Unknown
AA seq 343 aa
MMPPRLPGGHGGAMRSRSSSSGHHLNTTFHKGRRRRQQHHIGGSHISISHGSYLALLLLS
TTCSLVATSASSSSSAADTDIAPPDPPPVSQVSIASSSPCAPQHWWDSQRDRCTPCTRCQ
GEMIPLRPCQLHTDTICGSIYDLKIDWVVLAKTEPNWKERRKSSEYEHFEHNAPLQHLTH
EQLQQLHEEAAAAWVLDWQTGVLYVAVLTCLVFFSVAACILIHHMRQWRRMERRLDQDVE
ELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPASAATTHPATTQSGIFQPQHVLLPEKR
GKHQERRILKTLQPGNVYIEESNAGLGGMGVGLGVRGCSGLKG
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgatgccgccaagacttccaggcggccatggaggagccatgcgtagtcggagcagcagc
agtggccaccacttaaacacaacgtttcacaaaggccgacggaggcgacagcagcaccac
atcggtggcagccacatcagcatcagccacggcagctacctggccctgctactgctgtcc
accacctgctccctggtggccaccagcgcctcctcgtcatcctccgctgcagacacagac
attgcgccaccagatccgccgccggtcagccaggtgtccatcgcctccagctcgccctgc
gccccacagcattggtgggactcgcagcgggatcgctgcacaccgtgcacccgctgccag
ggcgagatgataccgctgcggccctgccagctacacacggacaccatctgcggctccata
tacgacctcaagatcgactgggttgtcctggccaagaccgaacccaactggaaggagcgc
cgaaagtcctccgagtatgagcacttcgagcacaatgccccactgcagcacctgacccac
gagcaactgcagcagctgcacgaggaggcggccgccgcctgggtcctcgactggcagact
ggcgtcctctacgtggccgtgctcacctgcctggtcttcttctcggtggccgcctgcatc
ctcatccaccacatgcgccagtggcgtcgcatggagcgtcgcctggaccaggatgtggag
gagctgtcgaccaagctgatggccaagctggcggaggtgcagagcctggacggaggcacc
ttcttcatcggcaacgcggacgccttgcgaggcctgcccgcctccgcagcgacgacgcat
ccagcaacgacgcagtcggggatcttccagccacaacacgtgctgctgcctgaaaaacgc
ggcaagcaccaggagcgacggatcctgaagaccctgcagcccggcaatgtctacatcgag
gagagcaacgctggattgggcggcatgggcgtgggcctgggcgtccgcggctgttccggc
ctgaagggctga

DBGET integrated database retrieval system