KEGG   Drosophila simulans: Dsimw501_GD28614Help
Entry
Dsimw501_GD28614  CDS       T01065                                 

Gene name
Dsim_GD28614
Definition
(RefSeq) GD28614 gene product from transcript GD28614-RA
  KO
K11253  histone H3
Organism
dsi  Drosophila simulans
Brite
Chromosome and associated proteins [BR:dsi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dsimw501_GD28614 (Dsim_GD28614)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsimw501_GD28614 (Dsim_GD28614)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 27208461
NCBI-ProteinID: XP_016022787
UniProt: Q76N01
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcaaactgcacgcaaatcgactggtggaaaggcgccacgcaaacaa
ctggctactaaggccgctcgcaagagcgcccctgcgactggaggtgtaaagaagccccac
cgctatcgccctggaacagtggccttgcgtgagatccgtcgctaccaaaagagcacagag
cttctgatccgcaaactgcctttccagcgtctggtgcgtgaaatcgctcaggactttaag
actgacttgcgattccagagctcggctgttatggccctgcaggaagctagcgaagcctat
ctggttggtctctttgaagataccaacttgtgtgccattcatgccaaacgtgtcaccata
atgccgaaggacatccaattagcgcgacgcatccgcggcgagcgtgcttaa

DBGET integrated database retrieval system