KEGG   Drosophila simulans: Dsimw501_GD29168Help
Entry
Dsimw501_GD29168  CDS       T01065                                 

Gene name
Dsim_GD29168
Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
dsi  Drosophila simulans
Pathway
dsi00330  Arginine and proline metabolism
dsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsimw501_GD29168 (Dsim_GD29168)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD29168 (Dsim_GD29168)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     Dsimw501_GD29168 (Dsim_GD29168)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Dsimw501_GD29168 (Dsim_GD29168)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 27209011
NCBI-ProteinID: XP_016031118
FlyBase: FBgn0270458
UniProt: A0A0J9RRX7
LinkDB All DBs
Position
3L
AA seq 356 aa AA seqDB search
MVDAAVLAKLEEGYAKLAASDSKSLLKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLEN
HDSGVGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASSFGDVSTFGNVDPTNEYV
ISTRVRCGRSMQGYPFNPCLTEAQYKEMEGKVSSTLSGLDGELKGKFYPLTGMEKAVQQQ
LIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLG
QIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEV
AAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgccgctgttctcgctaaactggaggagggttatgccaagctggctgcctcc
gactccaagtcgctgttgaagaagtacctgaccaaggaggtcttcgacaacctgaagaac
aaggtcacgcccaccttcaagtcgaccctgctggatgtgatccagtccggcctggagaac
cacgactccggcgtgggcatctacgctcccgatgccgaggcttacacagtgttcgccgac
ctgttcgaccccattatcgaggactaccatggtggcttcaagaagaccgacaagcacccg
gcctccagcttcggcgatgtgtccaccttcggcaacgttgaccccaccaacgagtacgtg
atctccactcgcgtgcgttgcggtcgctccatgcagggataccccttcaacccctgcttg
accgaggcccagtacaaggagatggaaggcaaggtcagcagcaccctgtccggtctggat
ggtgagctgaagggcaagttctaccccctgactggcatggagaaggccgtccagcagcag
ctgatcgacgaccacttcctgttcaaggagggcgatcgtttcctgcaggccgccaacgcc
tgccgcttctggcccagcggccgtggcatctaccacaacgatgccaagaccttcctggtc
tggtgcaacgaggaggaccatctccgcatcatctccatgcagcagggcggtgatctgggc
cagatctacaagcgtctggtgaccgccgtcaacgaaatcgagaagcgtgtgcccttcagc
cacgacgaccgtctcggtttcctgaccttctgccccaccaacctgggcaccaccatccgt
gcctccgtgcacatcaaggtgcccaagctggcctccaacaaggccaagcttgaggaggtt
gccgccaagtacaacctgcaggtgcgcggaacccgcggtgagcacaccgaggctgagggt
ggtgtctacgacatctccaacaagcgtcgcatgggtctgaccgagttcgaggccgtcaag
gagatgtacgatggcatcaccgagctgatcaagctcgagaagagcctgtaa

DBGET integrated database retrieval system