KEGG   Drosophila simulans: Dsimw501_GD29214
Entry
Dsimw501_GD29214  CDS       T01065                                 

Gene name
Dsim_GD29214
Definition
(RefSeq) uncharacterized protein
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dsi  Drosophila simulans
Pathway
dsi00230  Purine metabolism
dsi01100  Metabolic pathways
dsi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dsimw501_GD29214 (Dsim_GD29214)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dsimw501_GD29214 (Dsim_GD29214)
Enzymes [BR:dsi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Dsimw501_GD29214 (Dsim_GD29214)
SSDB
Motif
Pfam: AC_N Guanylate_cyc FXR_C1 Virul_fac_BrkB
Other DBs
NCBI-GeneID: 27209057
NCBI-ProteinID: XP_016039426
FlyBase: FBgn0270504
LinkDB
Position
X
AA seq 332 aa
MEANLENGQMTNASTSKSHSQRQTTSRRRQNDSDVAGGVGITGGGVVILPQHVLNELYHN
YSIKQRRSGLKWFVFAAALFNIWTIGIPWDQSAPTRVINCCMLVAYLALTALLHIGRRSG
KPALRRFHQILLIIVPRALWLLSILHFTVYVILQPSFSPSLPVGYSRWDSLLSNQLAANA
VLIATAALIGLLYYFMGEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIK
MREDLGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRL
AEVNLQKIKNFCLLMILIILIPLSFIFFAYIY
NT seq 999 nt   +upstreamnt  +downstreamnt
atggaagcaaatttggagaacggtcagatgacgaacgcctcgacaagcaaatcgcattcg
cagcgtcaaacaacatctcgtcggcggcaaaacgacagcgatgtggccggaggcgtggga
atcaccggtggcggagtcgtcattttgccgcagcacgtgcttaacgaactctatcacaac
tactccatcaaacaacgccgcagtggattgaagtggtttgtctttgcggccgcgttgttt
aacatatggaccatcgggattccctgggatcagtcggcccctacgagagtgatcaattgt
tgtatgctggtagcgtacttggcattgacagcgctccttcacattggacgccgttctggt
aaaccggcactgaggcgcttccaccaaatactcctgattattgtgccaagggcactgtgg
ctattaagcattcttcattttaccgtctatgttattttgcagcctagtttttccccaagt
ctgcctgttggttattctcgctgggactcgctgctctcgaaccagttagcggccaatgca
gttttaatagccacggcagcgctgataggccttttgtactactttatgggtgaggccaaa
cagaaaagagcatttctcgaggccaaaaagagccttgaagttaaaatggtcatagaggaa
cagtcggccgaacaggagcgtctgcttttgtctgtgctgcctaagcacgtggctatcaag
atgcgggaagatttgggatcatccagttccgaagcctttaaaaaaatctacatgagtcgg
cacgagaatgtaagcattctatatgcggatatcgttggctttaccgccatttcctccaca
tatagtgcgcaagatttggtaaaaatgcttaacgagctctttgcgcgtttcgacagactt
gctgaggtaaatttgcaaaaaataaaaaatttttgtctgttaatgattttgatcatttta
atacctttatcctttatttttttcgcttacatttattaa

DBGET integrated database retrieval system