KEGG   Dactylococcopsis salina: Dacsa_0430Help
Entry
Dacsa_0430        CDS       T02378                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00500  Starch and sucrose metabolism
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dacsa_0430
Enzymes [BR:dsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dacsa_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFZ49218
UniProt: K9YT13
LinkDB All DBs
Position
446656..449226
Genome map
AA seq 856 aa AA seqDB search
MKPIRTFNVSPSLPPKLEPLKKLAYNIHWDWNVETKDLFRRLDNQLWESCRHNPVALLGN
ISQSRLAEVAEDEGFIAQMERAEEQLDLYLQERNWFRKNRQQALGEECYAYFCAEYGLTD
CLPLYSGGLGVLAGDHLKSASDLGLPLIAVGLLYQEGYFSQYLNADGWQQEAYPISDFSN
MPLHLERKSDGSELRVEVDYPGRTVIARVWRIDVGGVRLYLLDTNIEGNSEYDHNITDRL
YGGDLDMRIHQEMMLGIGGFRALKALGYTPTVFHLNEGHSAFLVLERMRRLIEDDGLSFE
EAKQMVQASQMFTTHTPVSAGFDMFNPDQTMYYVGHYADIFGLSREEFLAMGRENTGDLS
SPFSMAALALRTSSFLNGVSKLHGEVSRDMFKGMWKGLPVSEVPITSITNGTHARSVVAK
STQQLYDRYLGPNWSDKGPDDPLWEKVNAIPDDELWRNHERARADMVVMVRDWLGKKLRQ
RGASQAELDKATEVLDPNVLTIGFARRFATYKRATLFLRDIDRIKKIIMGNPDRRLQFVI
AGKAHPKDMPGKELIRQLIHIAREEGIEEYLVFVPDYDTHVARAMVSGCDIWLNTPRRPR
EASGTSGMKAAMNGLPNLSVLDGWWDEADYTATGWAIGQGEIYEDQHYQDEVEANALYDL
LEQEILPLFYDRDANGVPRGWVQKMKNAIRLNIPQFNTARMLRDYSVYGYFPSSDRYFAM
TENNYANTKAVAQWKKQVFERWYDIRIESIDVSEETDIVVNETIEVKAVLDLAGLKPDDV
SVELYLGKLNSNGEIVNGTPIPMEHTGETTSAGVTYKGSLVYRASGLQGLSLRVLPKNQY
MAHPHELGLILWADDK
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcgtacctttaatgtttctccctcccttcccccaaaattagagccatta
aaaaagctcgcctacaatattcactgggattggaacgttgaaaccaaagacctctttcga
cgcttagacaaccaactgtgggaatcttgtcgtcataaccccgttgctctcctgggaaat
atcagtcaatcccgactggcggaagttgccgaagatgaaggcttcatcgctcaaatggag
cgagcggaagagcaactagacctctatttgcaagagcgaaactggtttcggaaaaaccgc
caacaagctctaggtgaagaatgttatgcctatttctgcgccgaatatggtttaaccgat
tgtcttcccctttattctggtggtttaggagttctcgctggtgatcatctcaaatcggct
agtgatttaggcttacctttgatcgcagtgggcttactttaccaagaagggtatttctcc
caatacttaaacgccgatggttggcaacaagaagcctatcccatcagcgactttagcaat
atgcccttacacctagaacggaagtctgacggctcagaattacgggtggaagtggattat
ccagggcgcaccgtgatcgctcgcgtctggcgcattgatgtgggaggagttcgcctctat
ctcctcgataccaacattgaagggaattccgaatatgatcacaatatcaccgatcgcctt
tatggcggtgatctcgatatgcggattcaccaagaaatgatgttgggaatcggtggtttc
cgcgctctgaaagccctcggctatactcccaccgtcttccaccttaacgaaggtcacagc
gcctttttagtcttagaacggatgcgtcgcctcattgaagatgatggcttgagctttgag
gaagcaaaacagatggtacaagccagccagatgttcaccactcatacgcctgtatccgca
gggtttgatatgttcaaccccgatcaaaccatgtattatgtgggacattacgccgatatc
tttggcttatcccgtgaagaatttttagccatgggacgagaaaatacgggtgatttatct
tctcccttcagtatggcagccttagcattacggacaagctctttccttaatggagtcagt
aaactgcatggggaagtgtcacgggatatgtttaagggaatgtggaaaggacttcccgtt
tctgaagttcccatcacctcgatcaccaatggcactcacgctcgtagcgtggtcgctaaa
tctacgcaacaactttacgatcgatatttaggtcccaactggtcggataaaggtcccgat
gatccgctttgggaaaaagttaatgccattcctgatgatgagttatggcgcaaccatgaa
cgcgctcgcgccgatatggtggtgatggtgcgtgactggctgggcaagaaattgcgccaa
cggggagcaagtcaggcggagttagataaagcaacggaagtgcttgatccgaatgtgtta
accatcggttttgcgcgacgctttgctacctacaaacgagcgactttattcctacgggat
atcgatcgcattaaaaagattatcatgggaaatcccgatcgacgcttgcaattcgtcatc
gctgggaaagcacacccgaaagatatgccagggaaagagttaattcgtcaactgatccat
atcgcacgggaagaagggattgaagagtatctcgtgtttgttcccgactatgacacccat
gtcgctcgtgccatggtttctggttgcgatatttggctcaatactccgcgtcgtccccgt
gaagcctctggaacatcaggcatgaaagcggcaatgaatggactgcctaatctcagcgtt
ctcgacggctggtgggatgaggcggattacaccgctacaggttgggcaattggtcaagga
gaaatttacgaagaccaacactatcaagatgaagtggaagccaatgcgctctatgatctc
ctagagcaagagattcttcccctattttacgatcgagatgccaatggtgttcctcgcggt
tgggtgcaaaaaatgaaaaatgcgattcgcttgaatataccgcaatttaacaccgcacgg
atgctacgagattacagtgtctatggttattttcccagcagcgatcgttatttcgccatg
acggaaaataattatgcaaacaccaaagccgtcgcccaatggaaaaaacaagtctttgag
cgttggtatgacatcagaattgaaagcattgatgtttccgaagaaaccgacattgttgtc
aacgaaacgattgaggtaaaagccgttttagacttagcgggtttaaaacctgatgatgtg
agcgtagaactttatttaggaaaactcaacagcaatggcgagattgttaatggaactccc
attccgatggaacacacgggagaaaccaccagcgctggtgtcacttataaaggttctctc
gtttaccgcgccagtggcttacaagggttatccttgcgcgtcttacccaaaaaccaatac
atggcacatccccatgaattaggcttaattctctgggctgacgataagtaa

DBGET integrated database retrieval system