KEGG   Dactylococcopsis salina: Dacsa_1744Help
Entry
Dacsa_1744        CDS       T02378                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00620  Pyruvate metabolism
dsl00680  Methane metabolism
dsl00710  Carbon fixation in photosynthetic organisms
dsl01100  Metabolic pathways
dsl01120  Microbial metabolism in diverse environments
dsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dacsa_1744
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Dacsa_1744
   00680 Methane metabolism
    Dacsa_1744
Enzymes [BR:dsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dacsa_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFZ50408
UniProt: K9YWA8
LinkDB All DBs
Position
complement(1768780..1771803)
Genome map
AA seq 1007 aa AA seqDB search
MSSLLQASSEDTNDASRDQFLDRRIKLIEKLWESVLRAECGQELVNLLQQLRSMGSPEGQ
ATGLPTSSVPQLIEELPLNDAVRAARAFALYFQLINIVEQHYEQREQQLNRLGDEEKNNK
QFSHQKEAEPQHSLLGAELLEKTWQGNSTYQKAGTFNWLFPYLKRLNVPPQQVQRLLNQL
EVRLVFTAHPTEIVRQTIRKKQRRIAKILEQIDYNEATTKSLNFFESPEAVESTEQLEEE
IRLWWRTDELHQFKPEVLDEVDYALHYFQEVLFDTMPQLAKRLKKALKGSFKELTPPRNH
FCRFGSWVGADRDGNPSVTPEVTWETACYQRGIVLERYLHSVKQLTTLLSLSLHWSDVLP
ELLESLEDDRAVMPEVYERLAIRYRREPYRLKLAYIEKRLEHTIQRNQSLYSGEQSQQEA
IKKHPKTIYKSDADFLAELKLIQRNLIETGLACQDLEDLIAQVEIYGFNLAELDMRQESS
RHSETLDEITEYLQILPQSYHQLSESERVKWLSEELQTRRPLIPGELPFSEKTQETVETF
RLLKKLQQEFGTQVCRTYIISMSHEVSDILEVLLLAKEAGIYDPATGSCSLQVVPLFETV
DDLLSAPEIMKALFELPLYRACLAGGYGLEKASNQYDIQEVMLGYSDSNKDSGFLSSNWE
IHKAQKALQSLAEGYGVSLRIFHGRGGSVGRGGGPTYEAILAQPSSTINGRIKITEQGEV
VASKYSLPDLALYHLETATTAVIQGSLLGSGFDDIGPWNSIMEELADRSRQHYRSLIYEE
PDFLDFFLSVTPIQEISQLQISSRPARRQGGKKDLSSLRAIPWVFSWTQTRFLLPAWYGV
GTALKGFLDEETERNREHNLKLLRYFYWKWPFFRMVVSKVEMTLAKVDLQIAHHYLKELA
NSEDYDRFERIFKQIADEYYLASELIRLITDHEKLLDGDPDLQRSVQLRNRTIVPLGFLQ
VSLLKRLREYSNQSASGVIHFRYSKEELLQGALLTLNGIAAGMRNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgagttctctgttgcaagcatccagcgaagatactaacgacgcatctcgtgaccaattc
ctcgatcgacgaattaaactgatagaaaagttatgggaatccgtattaagagcagaatgt
ggtcaggaattagtaaatttactgcaacagttgcgctctatgggatcaccagaaggacaa
gccacaggattacccacatcatccgtaccgcaactaattgaggaacttcccctcaacgat
gcagtaagagccgctcgcgcctttgctttatactttcaattaattaatatcgttgaacaa
cactatgaacaacgggaacaacaattgaaccgtcttggagatgaggaaaaaaacaacaaa
caattttcccatcaaaaggaagccgaacctcaacacagtctcctcggtgcagaactttta
gaaaaaacttggcaaggaaattccacctatcaaaaagctggtacatttaactggttattt
ccctacttaaaacggctcaacgttcctccccaacaagtccaacgcttactcaaccagtta
gaagttcgtctcgtctttaccgcgcaccccacagaaattgttcggcaaacgattcggaaa
aaacagcgtcgcattgccaaaattttagagcaaattgattacaatgaagcaaccactaaa
agtttaaactttttcgagtctccagaagcagtggaatcaacggaacaactagaagaggag
attcggttgtggtggcgcactgatgaattgcatcagtttaaacctgaagttttagacgaa
gtagattatgcactacattactttcaagaagtgttattcgacacgatgcctcagttggcg
aaacgactaaaaaaggcactgaaagggtcttttaaggaattaactcccccaagaaatcat
ttctgtcgctttggatcatgggtaggggccgatcgagatggcaatccctcagtaactccc
gaagtaacttgggaaaccgcctgttatcagcgaggaattgtcttagaaagatatctccat
tcagtgaagcaactgaccactttattaagtttatctttacattggagtgatgttctgcct
gaactattagaatccttagaagacgatcgcgcggtaatgccagaagtttacgaacggtta
gcaattcgctatcgccgagaaccttatcgcttaaaacttgcctacattgaaaagcgttta
gaacataccatacagcgcaaccaaagtttatattcaggagagcaatcgcaacaggaagct
attaaaaaacatccgaaaacgatttataaatcagacgcagattttctagcagaattaaaa
ctgattcagcgtaatctaattgaaacaggattagcttgtcaagacttagaagatttaatt
gctcaagtcgaaatttatggttttaacttagctgagttagatatgcgtcaagagtcgtct
cgtcattccgagacattagacgagattacagaatacttacaaattttaccgcaatcttat
catcaactctcggaatcagaacgagtcaaatggctcagtgaagaactacaaactcgtcgc
cctctcattcctggagaacttcctttttccgaaaaaacccaagaaaccgtagaaaccttc
cgtcttttaaagaagctacaacaagaatttgggacacaagtttgtcgcacttatattatt
agtatgagccatgaagtgagtgacattttagaagtccttctcttggcaaaagaagcagga
atttatgatccagcaacgggaagctgtagcttacaagttgttcccttatttgaaacagtg
gatgatttattaagcgctcccgaaataatgaaagcgttgtttgaattacctttatatcga
gcttgtttagcaggaggatatggtctggaaaaagcaagcaatcagtatgatatacaagag
gtaatgctcggttattctgatagtaataaagattcgggatttttaagcagcaattgggaa
attcataaggcgcaaaaagcactccagagtttagcggaaggttatggggtttctttacgc
atttttcacggacgagggggatcagtgggacgcggtggcggccccacttatgaggcaatt
ttggcacagccgagttctacaatcaacggacggattaaaattacagaacagggagaagtg
gtcgcctctaaatactctctccccgatcttgccttgtatcatttggaaaccgcaacaacc
gcggtgattcaggggagtttactgggaagtggatttgatgatatcggaccctggaatagt
attatggaggaattggcggatcgatcgcgccaacattatcgttccttgatttacgaagaa
ccagactttttagatttcttcctttctgttactcccatccaagaaatcagccaattacaa
attagttctcgtcccgctcgtcgtcaagggggaaagaaagatttaagctctttacgagcg
attccctgggtgttcagttggacacaaacccgttttttacttcccgcttggtacggtgtc
ggaacagcattaaaaggctttttagatgaagaaaccgaacggaatcgcgaacataactta
aaattgttgcgttatttctattggaaatggccctttttccgtatggtggtttctaaggta
gagatgactttagcaaaagttgatctgcaaattgcccatcattatctcaaagaattagct
aactccgaagattacgatcgatttgagcgtatctttaaacaaattgcagatgaatattac
ctcgcaagcgaattaatccgtttaatcaccgaccatgagaaactcctagatggtgatcca
gatttacagcgctcagtacagctacgaaaccgaacgatcgttcctcttggttttttacaa
gtctctcttctcaagcgtctccgtgaatacagtaatcaaagcgcgtcgggagtgattcat
ttccgatacagtaaagaagagttattacagggagcattattaaccctaaatggcattgct
gcgggaatgcgaaacacgggttag

DBGET integrated database retrieval system