KEGG   Dactylococcopsis salina: Dacsa_1769Help
Entry
Dacsa_1769        CDS       T02378                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00630  Glyoxylate and dicarboxylate metabolism
dsl00710  Carbon fixation in photosynthetic organisms
dsl01100  Metabolic pathways
dsl01120  Microbial metabolism in diverse environments
dsl01200  Carbon metabolism
Module
dsl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
dsl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
dsl_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dsl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dacsa_1769
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Dacsa_1769
Enzymes [BR:dsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Dacsa_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small PAS_4
Motif
Other DBs
NCBI-ProteinID: AFZ50430
UniProt: K9YVR1
LinkDB All DBs
Position
1800589..1800975
Genome map
AA seq 128 aa AA seqDB search
MTQTLLNSLFVNTGFETMKTTPKQAFYETLSYLPPLTDQQIAKQIQYMLDQGFIPAIEFE
ESPKPQDHHWTLWKLPLFDASSPQDVLNEVRECRSEYSNCYIRVVGFDNIRQCQMVSFIV
YKPDGIRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgctactgaatagtctctttgtaaatactggatttgaaaccatgaaaaca
acaccgaaacaagccttttacgaaaccctttcttatttacctcctctcactgatcagcaa
attgccaagcaaattcagtatatgctggatcaaggctttatccctgctattgagtttgaa
gagtcccctaaacctcaagatcaccactggacattgtggaaattacctttatttgatgca
agttctcctcaagatgtcttaaatgaggtgcgggaatgccgttctgagtattctaactgc
tacatccgtgttgttggttttgataatatccgtcaatgccaaatggttagctttatcgtt
tacaagcccgacggtatccgttattaa

DBGET integrated database retrieval system