KEGG   Dactylococcopsis salina: Dacsa_1939Help
Entry
Dacsa_1939        CDS       T02378                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00970  Aminoacyl-tRNA biosynthesis
dsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dacsa_1939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dsl03029]
    Dacsa_1939
Enzymes [BR:dsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dacsa_1939
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dacsa_1939
Mitochondrial biogenesis [BR:dsl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dacsa_1939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFZ50590
UniProt: K9YW68
LinkDB All DBs
Position
complement(1967274..1968731)
Genome map
AA seq 485 aa AA seqDB search
MASIRELHEQLVKKERSALEVTRETLARIEAVEEKVHSYLHILATEAEAAAQKVDEKIAA
GDSIALLEGIPIAIKDNMCMKGVPTTCGSRILENFVPPYESTVTGKLKTAGAVLLGKTNL
DEFAMGSSTENSAYALTCNPWDLSRVPGGSSGGSAAAVAAEECVVALGSDTGGSIRQPAS
FCGVVGLKPTYGLVSRFGLVAFASSLDQIGPFGRTVEDTAILLGAIAGHDPADSTSLQVK
IPDYTQYLTPELPKNPKLKIGVITETFGEGLSDEVKTAVQGAIEQLGAIGAEIVEISCPR
FRYGLPAYYIIAPSEASSNLARYDAVRYGKRNEEADNLLSMYQKTRAEGFGAEVKRRIMV
GTYTLSAGYYDAYYLKAQKVRTLIKQDFEKAFETVDLLVCPTAPTTAFKAGEKTDDPLSM
YLSDLTTVPVSLAGLPALNIPCGFDAQGLPIGMQLIANVLREDQLLQTAYAYEQATDWHQ
KRPQL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatccgagagttacatgaacagttggtgaagaaggaacgctctgcgctagag
gtgacacgggaaactctggctcggatcgaagcggtagaggaaaaggtgcatagttatcta
catattttagcgacggaagcagaagccgccgcccaaaaggtggatgaaaaaattgccgca
ggagattcgatcgcgcttttagagggaattccgatcgcgatcaaggataatatgtgcatg
aagggtgttcccactacttgtggctctcgtattctagagaattttgttcctccctatgaa
tctactgtcactggcaaactaaaaacagcgggagcagttttactgggaaaaactaatctt
gatgagtttgcaatgggaagctcgacagaaaattccgcttacgcgctcacttgtaacccc
tgggatttatcacgagtgcctggtggctcttctggcggatcggccgccgctgtagcagca
gaggaatgtgtggtggcgttgggatcggatacaggaggatcaattcgtcaacctgcttct
ttttgcggtgtagtgggcttaaaacccacctatggtttagtctctcggtttggtttggtg
gcgtttgcgtcttctttagatcaaattggtccctttgggcgcaccgtagaggatacggcg
attttattgggggcgatcgcgggtcatgatccagccgacagcaccagtttacaggtgaaa
attcccgactatacccaatatctcaccccagagttacccaaaaatccgaaactcaaaatt
ggtgtgattacagaaacctttggggaaggactctccgatgaggtaaaaaccgcagtacaa
ggggcgatcgagcagttaggggcaatcggtgcggaaatcgtagaaatctcctgtcctcgt
tttcgctatggcttaccagcctactacattatcgccccttcggaagcatcttctaattta
gcccgttacgatgcggtacgctacggaaaacgcaacgaagaagcggacaatctcctctcg
atgtatcaaaaaacccgtgccgaaggatttggggctgaggtgaaacgtcggattatggtg
ggaacttacaccctgtctgcaggttattatgatgcctattacctgaaagcgcaaaaagtc
cgaaccctgattaaacaagattttgaaaaagcctttgagacggtagatttgttggtttgt
cccaccgctcccacgactgcttttaaggcgggagaaaaaacggatgatccattaagtatg
tatctttccgatttaactactgttcccgtcagtttagcaggtttacccgctttaaatatt
ccctgtggcttcgatgctcaaggtttaccgatcgggatgcaattaattgctaatgtatta
cgagaagaccaattgttacaaacggcttatgcttatgagcaagcaaccgattggcatcaa
aaacgtcctcaactctag

DBGET integrated database retrieval system