KEGG   Dactylococcopsis salina: Dacsa_2317Help
Entry
Dacsa_2317        CDS       T02378                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00010  Glycolysis / Gluconeogenesis
dsl00020  Citrate cycle (TCA cycle)
dsl00620  Pyruvate metabolism
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
dsl01120  Microbial metabolism in diverse environments
dsl01130  Biosynthesis of antibiotics
dsl01200  Carbon metabolism
Module
dsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacsa_2317
   00020 Citrate cycle (TCA cycle)
    Dacsa_2317
   00620 Pyruvate metabolism
    Dacsa_2317
Enzymes [BR:dsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dacsa_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL SOG2 Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID: AFZ50931
UniProt: K9YVH9
LinkDB All DBs
Position
complement(2355773..2357062)
Genome map
AA seq 429 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWAKSQGEKVEKGETVLVVESDKADMDVESFHDGYLATIL
VPEGEQAPVGSTIGLLAETEAEIETAKQQGSNQTTATTAKTETKTETPVAPSSTPEPATP
TPQVASTPTSTPKQENGRVVASPRARKLAKEHNIDLATLQGSGPHGRIVASDVEAATGQP
TATPQPQPTPQPAPQPTPQAAPSYAKGEVVPFTTLQSSVVRNMTATVQVPTFHVGYTITT
DALDKLYKQIKSKGVTMTALLAKAVAATLQKHPLVNASYSEQGIQYHSGINIAVAVAMED
GGLITPVLRNAAEQDIYTLSRNWKDLVKRSRSKQLQPEEYSTGTFTLSNLGMFGVDRFDA
ILPPGQGGILAIGASRPQVVATDDGMFGVRRQMSVNITCDHRIIYGAHAAAFLQDLAQLI
ETDPQSLTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgacatcttcatgcctgctctcagttcaaccatgaccgaaggaaaaattgtc
tcttgggcaaaatctcaaggggaaaaagtagagaaaggagaaaccgtccttgtagtggaa
tcagacaaagcagatatggatgtggagtcgttccatgatggttatttagcgacaattctt
gttccagaaggagaacaagcgccagtgggttctaccattggtttactcgcagaaaccgaa
gcagaaattgaaactgctaaacaacaaggaagcaatcaaaccaccgcaaccactgcgaaa
acagaaacgaaaacggaaacacctgttgctccctcctcaactccagaacccgcaacaccg
actcctcaagtagcttctacgccaacttccactccgaaacaagagaatggtcgcgttgtg
gcttctcctcgcgctcgtaaattagcaaaagagcataatatcgatctcgcaaccttacaa
ggaagcggtccccatggtcgcattgttgcttctgatgtggaagcggcgactggtcaaccg
acggcgactcctcaaccgcaaccgacaccgcaaccagccccccaaccgacaccacaagct
gcaccaagctacgcgaagggagaagttgtcccctttacgactctccaaagttctgtggta
cggaatatgaccgcaacggtacaagttcccactttccatgtcggttataccatcaccact
gatgcgttagataaactctataaacaaattaaatcgaaaggggtgacaatgacggcgtta
ctggcgaaagctgtggcggctactttacaaaaacatccccttgttaatgccagttacagt
gagcaagggatacaatatcactctggaattaatatcgctgttgcggtggcgatggaagat
ggcggtttgattactcctgttttacgcaatgcagcagaacaggatatttataccctttct
cgcaattggaaagatttagtgaaacgatcgcgcagtaagcaattacagccagaagaatac
agcaccggcacgtttactctatcgaatcttggaatgtttggggtcgatcgatttgatgcc
attttaccccctggacagggtggcattctagcaattggtgcgtcccgtccccaagttgta
gcgaccgatgatggaatgtttggtgtgcgtcgtcagatgagtgttaatatcacttgcgac
caccgcattatttatggcgctcatgcggcggctttcttacaagatttagcacagttgatc
gaaactgatcctcaaagtttaactctgtaa

DBGET integrated database retrieval system