KEGG   Dactylococcopsis salina: Dacsa_2317
Entry
Dacsa_2317        CDS       T02378                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00010  Glycolysis / Gluconeogenesis
dsl00020  Citrate cycle (TCA cycle)
dsl00620  Pyruvate metabolism
dsl01100  Metabolic pathways
dsl01110  Biosynthesis of secondary metabolites
dsl01120  Microbial metabolism in diverse environments
dsl01200  Carbon metabolism
Module
dsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacsa_2317
   00020 Citrate cycle (TCA cycle)
    Dacsa_2317
   00620 Pyruvate metabolism
    Dacsa_2317
Enzymes [BR:dsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dacsa_2317
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL SOG2 Ribosomal_L18p
Other DBs
NCBI-ProteinID: AFZ50931
UniProt: K9YVH9
LinkDB
Position
complement(2355773..2357062)
AA seq 429 aa
MIRDIFMPALSSTMTEGKIVSWAKSQGEKVEKGETVLVVESDKADMDVESFHDGYLATIL
VPEGEQAPVGSTIGLLAETEAEIETAKQQGSNQTTATTAKTETKTETPVAPSSTPEPATP
TPQVASTPTSTPKQENGRVVASPRARKLAKEHNIDLATLQGSGPHGRIVASDVEAATGQP
TATPQPQPTPQPAPQPTPQAAPSYAKGEVVPFTTLQSSVVRNMTATVQVPTFHVGYTITT
DALDKLYKQIKSKGVTMTALLAKAVAATLQKHPLVNASYSEQGIQYHSGINIAVAVAMED
GGLITPVLRNAAEQDIYTLSRNWKDLVKRSRSKQLQPEEYSTGTFTLSNLGMFGVDRFDA
ILPPGQGGILAIGASRPQVVATDDGMFGVRRQMSVNITCDHRIIYGAHAAAFLQDLAQLI
ETDPQSLTL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgatccgtgacatcttcatgcctgctctcagttcaaccatgaccgaaggaaaaattgtc
tcttgggcaaaatctcaaggggaaaaagtagagaaaggagaaaccgtccttgtagtggaa
tcagacaaagcagatatggatgtggagtcgttccatgatggttatttagcgacaattctt
gttccagaaggagaacaagcgccagtgggttctaccattggtttactcgcagaaaccgaa
gcagaaattgaaactgctaaacaacaaggaagcaatcaaaccaccgcaaccactgcgaaa
acagaaacgaaaacggaaacacctgttgctccctcctcaactccagaacccgcaacaccg
actcctcaagtagcttctacgccaacttccactccgaaacaagagaatggtcgcgttgtg
gcttctcctcgcgctcgtaaattagcaaaagagcataatatcgatctcgcaaccttacaa
ggaagcggtccccatggtcgcattgttgcttctgatgtggaagcggcgactggtcaaccg
acggcgactcctcaaccgcaaccgacaccgcaaccagccccccaaccgacaccacaagct
gcaccaagctacgcgaagggagaagttgtcccctttacgactctccaaagttctgtggta
cggaatatgaccgcaacggtacaagttcccactttccatgtcggttataccatcaccact
gatgcgttagataaactctataaacaaattaaatcgaaaggggtgacaatgacggcgtta
ctggcgaaagctgtggcggctactttacaaaaacatccccttgttaatgccagttacagt
gagcaagggatacaatatcactctggaattaatatcgctgttgcggtggcgatggaagat
ggcggtttgattactcctgttttacgcaatgcagcagaacaggatatttataccctttct
cgcaattggaaagatttagtgaaacgatcgcgcagtaagcaattacagccagaagaatac
agcaccggcacgtttactctatcgaatcttggaatgtttggggtcgatcgatttgatgcc
attttaccccctggacagggtggcattctagcaattggtgcgtcccgtccccaagttgta
gcgaccgatgatggaatgtttggtgtgcgtcgtcagatgagtgttaatatcacttgcgac
caccgcattatttatggcgctcatgcggcggctttcttacaagatttagcacagttgatc
gaaactgatcctcaaagtttaactctgtaa

DBGET integrated database retrieval system