KEGG   Dactylococcopsis salina: Dacsa_3084Help
Entry
Dacsa_3084        CDS       T02378                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dsl  Dactylococcopsis salina
Pathway
dsl00473  D-Alanine metabolism
dsl00550  Peptidoglycan biosynthesis
dsl01100  Metabolic pathways
dsl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Dacsa_3084
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dacsa_3084
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Dacsa_3084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dsl01011]
    Dacsa_3084
Enzymes [BR:dsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Dacsa_3084
Peptidoglycan biosynthesis and degradation proteins [BR:dsl01011]
 Precursor biosynthesis
  Amino acid ligase
   Dacsa_3084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFZ51614
UniProt: K9YXG4
LinkDB All DBs
Position
3158853..3159902
Genome map
AA seq 349 aa AA seqDB search
MSKLRIGLLFGGCSGEHEVSIRSASAIAQAFQSEKNTPQYDLIPIYIQKNGIWKGGETAQ
TVLEKQTPPTLQPSGNRWEFPSEVSEVDVWFPILHGPNGEDGTIQGLLKLMQVPFVGSGV
LGSALGMDKLAMKTAFAAAGLPQVKYKQVKRDKIWSSPCVFPKLCDEVEEEIGYPCFVKP
ANLGSSVGISKAKTRSELETALDEAANYDRRIIVEQGIIAREVECAILGNEYPQASVVGE
ISYNSDFYDYATKYTTGEAKLYIPAPLPDKIFKQVQDLAKQAFVTVDAAGLARVDVFYEE
ATGKVYLNEINTLPGFTATSMYPRLWEATGIPFPQLVDRLIHLALQRHQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttacgaattggattattatttggtgggtgttctggagaacatgaggtgtca
atccgttctgctagtgcgatcgcgcaggcttttcaatccgagaagaacactccccaatat
gatttaattccaatttacatccagaaaaatggtatctggaagggaggagaaaccgcgcaa
acggttttagaaaaacaaacccctcccacgcttcaaccgtcaggaaaccgatgggagttt
ccctcagaagtgagtgaggttgatgtttggtttccgattttacatggtccgaatggggaa
gatggaacaattcaaggattactaaaactaatgcaagttccttttgtcggtagtggtgtg
ttaggttcagctttagggatggataagttagcaatgaaaaccgcgtttgcggcggcggga
ctgcctcaagtaaagtataaacaagtgaaacgagataaaatctggtcgagtccttgtgtt
tttcctaaactatgtgatgaagtggaggaggaaattggttatccttgttttgtgaaacca
gctaatctagggtcatcggtgggcatatcgaaagcgaaaactcgatcggaactggaaacg
gcgttagatgaagctgccaactacgatcgacgcatcatcgtcgaacagggaattatcgcc
agagaagtcgaatgtgcgattttagggaacgaatatccccaagcgtcagtagtgggagaa
atcagctacaattccgacttttacgattacgccacgaaatacaccacaggtgaagcgaaa
ctctacattccagccccgcttcctgataaaatctttaaacaggtacaagacctcgcgaaa
caagcctttgtcaccgttgatgcagcgggtttggcgcgtgtggatgtcttttatgaggaa
gcaacaggaaaggtttatcttaacgagatcaacacgctgccgggatttaccgccaccagt
atgtatcctcgtttatgggaagccactggtattccttttccccagttggttgatcggtta
attcacttagccttacaacgacatcagtaa

DBGET integrated database retrieval system