KEGG   Dickeya solani: A4U42_02500Help
Entry
A4U42_02500       CDS       T04410                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
dso  Dickeya solani
Pathway
dso00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dso00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A4U42_02500
Enzymes [BR:dso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A4U42_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434 DUF4838 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ANE74300
LinkDB All DBs
Position
complement(624054..626111)
Genome map
AA seq 685 aa AA seqDB search
MKRFPPLNPKVDGLLHGADYNPEQWENYPGIIDDDIAMMKQVKCNVMSVSIFSWAKLEPQ
EGVYRFDWLDEVIDKLYRQGIAVFLATPSGARPAWMSQRYPEVLRVGRDRVPALHGGRHN
HCLSSPVYRDKVAKINTLLAERYGHHPAVIGWHISNEYSGECHCDRCQQAFRTWLQARYQ
TLDNLNHAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQATDFCTQEIAP
LKRVNPAIPVTTNFMEYFYDYDYWQLSRVLDFISWDSYPMWHRDKDDATLACYIAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHVDTRVGREVAQLGQILSQLGAVAGSRVEAQVAILFDWESRWAMDDA
QGPRNAGLEYEKTVAEHYRPFWEQGIAADIINADCDFSGYRLLIAPMLYMVRPGFAERVE
QFVRQGGQVVVTYWSGIVNESDLCYQGGFPGPLRSVLGIWSEEIDCLADGEYNRVLGLAD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNRVGAGKAWYVTSRNDLA
FQRDFFAAIIRELALPRALDIPLPPAVTAHRRTNGDEEFIFIENYSALPQPIQLPAGHSD
MLTGLPLVDVVLSAWDCRVIRRRLV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttccacctttgaatccgaaggtcgatgggttattacatggcgctgattat
aatccggagcaatgggagaattaccccggcattattgatgacgatatcgccatgatgaag
caggtaaaatgcaatgtgatgtcggtcagtattttcagctgggccaaactggagccgcag
gaaggcgtgtatcggttcgactggctggatgaggtgattgataaattatatcggcagggc
attgcggtgtttctggctacgcccagcggcgcgcgtccggcatggatgtcgcaacgttat
ccggaagtgctgcgcgtagggcgcgaccgggtgccggcgctgcacggcggtcgccataac
cactgtctgtcgtcgccggtgtaccgcgataaagtagcgaaaatcaatacgctgctggca
gagcgctacgggcatcaccccgcggtgatcggctggcatatttccaatgaatacagcggc
gagtgccattgcgatcgctgtcagcaggcgttccgcacctggctgcaggcacgctatcag
acgctggacaacctcaatcatgcctggtggagcgatttctggagtcatacctacagcgac
tggtcgcagattgaatcgccggcgccgcagggggaagtgtccattcacggcttgaacctc
gactggagacgctttaataccgcgcaggcgaccgatttctgcacgcaggaaatcgccccg
ctgaagcgggtgaacccggctatcccggtcaccaccaatttcatggagtatttctatgat
tacgattactggcagctgtcgcgcgtgctggacttcatctcctgggacagctacccgatg
tggcaccgcgacaaggacgacgccacgctggcctgttatatcgcgatgttccatgacctg
atgcgctcgctcaagcagggcaaaccgtttgtgctgatggagtcgacccccagcgtcacc
aactggcagccgctcagcaagctcaagaagccgggcatgcatattctctcctcgctacag
gcggtggcgcacggcgcggatgcggtgcagtatttccagtggcgtaagagccgcggctcg
gtggagaaattccacggcgcggtggtggatcatgtcggccatgtcgatactcgcgtcggc
cgcgaagtggcgcagctcggtcagattttgtcgcagttgggtgcggtggcgggcagccgg
gtagaggcgcaggtggctatcctgtttgactgggaaagccgctgggcgatggatgacgcg
caggggccgcgcaatgccgggctggagtacgaaaaaaccgtggcggaacattaccgcccg
ttctgggaacaggggatcgcggcggacatcatcaacgccgactgcgatttcagcggctac
cggttgttgattgcgccgatgctgtacatggtgcgcccgggttttgccgagcgtgtcgag
cagtttgtgcggcaaggcgggcaggtggtggtgacctactggagcggtatcgttaatgaa
agcgacctgtgttatcagggcggatttcccggtccgctgcgttcagtgctggggatttgg
tcagaagagatcgactgtctggccgacggtgaatacaaccgggtactggggctggcggac
aatgacatcgggctgaaagggccgtatcaggcgcgccacctgtgcgagttgatccacctt
gaaggcgcgacggcgctcgccagctactgtgacgatttctacgccggccggccggcggtg
acggtaaaccgcgtcggcgcagggaaggcctggtacgtgacttcgcgtaacgatctggcg
ttccagcgcgatttctttgccgccatcatccgtgagctggctctgccgcgggcgttggat
atcccgctgccgccggcggtaacggcccatcgccgtaccaacggcgacgaagagtttatc
ttcatcgaaaactacagcgcgctgccgcagccaatccaactgcccgccgggcatagcgat
atgctgaccgggttgccgctggtggacgttgtcctttccgcctgggattgccgggtgatt
cgccgccgtctggtctga

DBGET integrated database retrieval system