KEGG   Dickeya solani IPO 2222: A4U42_11675Help
Entry
A4U42_11675       CDS       T04410                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dso  Dickeya solani IPO 2222
Brite
KEGG Orthology (KO) [BR:dso00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A4U42_11675
Enzymes [BR:dso01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A4U42_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 Glutaredoxin HI0933_like NAD_binding_8 Thi4 FAD_binding_3 DAO AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ANE75935
LinkDB All DBs
Position
2717174..2718736
Genome map
AA seq 520 aa AA seqDB search
MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTEIAGLSDKVSFFENNDLPV
RKPSFLITNPGSANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAKELLDQIRCLDGKFH
FETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLGEIVGKVDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
VGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETVSGAVLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRATDSVHKLALEGIFVQIGLLPNTGWLEGAVDRNRIGEIEIDARCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataacatgcagctccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttagtggcgacgctggacgactcagccaaatccgctgaagttcgggaactgctg
accgaaatcgccggattgtccgacaaagtcagtttctttgaaaataacgatctgccggtg
cgtaagccttcgttcctgataaccaatccggggtcggccaacgggccgcgctttgccggt
gcgccgatggggcacgaatttacctcgctggtgctggcgttgctgcaaaccggtggtcac
ccgtcgaaagaagcgaaagaattactcgatcaaatccgctgtctggacggtaagttccac
tttgaaacctattactcgctgacctgccacaactgccctgatgtggtgcaggcgctgaat
ttaatgtccgttctgaacccgaacgtcacccacaccgcgattgacggcggcgtgtttcag
gatgagatcaaagaccgcaatatcatgggtgtgcccacggtattcctcaacggcgaacat
ttcagccagggccgcatgagcctgggcgaaatcgtcggcaaggtagacaccggcgccaac
gcccgcgtggtcgacaaactgaacagccgcccggtgtatgacgtgctgatcgtcggcagt
ggccctgcgggggcggccgcggccgtgtacgcggcccgtaaggggatccgcaccggtctg
gtgggcgagcgtttcggcggccagattctggataccgtcgatatcgaaaactacatttcg
gtgccgaagaccgaaggcgccaaactggcgaccgcgctgaaaacccacgtggacgactac
gatgtcgacgttatcgatctgcagagcgcgcaaaaactgattccggcttccgaaccgggt
cagccgcaccagattgaaaccgtctccggcgcggtgctgaaatcccgcagcatcatcatt
gctaccggcgcgcgctggcgcaacatgaacgtgccgggcgaagatcagtaccgcacccgc
ggcgtgacctattgcccgcactgcgacggcccgctgttcaaaggtaagcacgtggcggtg
atcggcggcggcaactccggcgtggaagcggctatcgacctggcgggcgtggtgaaacac
gttaccctgctggagttcgcgccggaactgaaagcggattcagtgttgcaggacaaactg
cgcagcctgccgaacgtggacgtgatcgtgaacgctcagactaccgaagtcttgggcgac
ggccagaaagttaccggcctgcagtacaaggatcgcgctactgacagcgttcacaagctg
gcgctggaagggattttcgtacagatcggcctgctgcccaacaccggctggctggaaggc
gcggttgaccgcaaccgcattggtgaaatcgagatcgatgcccgctgcgaaaccagcgtg
aaaggcgtatttgcggcgggcgactgcaccaccgtaccttacaagcagatcatcatcgcc
accggcgaaggggccaaggcttccctgagcgcgtttgattatttgatcagaacccaggcg
tga

DBGET integrated database retrieval system