KEGG   Dickeya solani IPO 2222: A4U42_12250Help
Entry
A4U42_12250       CDS       T04410                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00790  Folate biosynthesis
dso01100  Metabolic pathways
Module
dso_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A4U42_12250 (folP)
Enzymes [BR:dso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A4U42_12250 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ANE76039
LinkDB All DBs
Position
2840200..2841033
Genome map
AA seq 277 aa AA seqDB search
MKLNARGLTLDLSCPQIMGILNVTPDSFSDGGKHNTLNTALIHAEQMISAGATFIDVGGE
STRPGADEVSTDEELERVVPVVEALAQRFETWISVDTSKPEVITASAQAGAHLINDIRAL
REPGALEAAAATGLPVCLMHMQGLPRTMQHTPHYDDVVGEVSAFFEHHIARCVAAGIPRD
QLLLDPGFGFGKNLQHNYRLLGHLEELHRFGLPLLVGMSRKTMIGQLLGVPPLERVHGSV
ACAVIAAMKGAHIIRVHDVKATVDAIRVVEATLSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacgctcgtggattgacgctggatctctcctgtccccaaattatggggatt
ttgaatgtaaccccggattccttctctgacggcggtaaacacaacacgctgaacactgct
ttaattcatgccgagcaaatgatttctgctggcgccactttcattgatgtggggggcgaa
tctacccgaccgggcgcagatgaagtcagcaccgatgaagagctggagcgggttgtgccg
gtggtggaagcgttggcgcaacgctttgaaacctggatttcagtggatacgtccaagcca
gaagtgattactgccagcgcgcaggccggcgcgcacctgatcaacgatattcgggcgctt
agagaaccgggggcgctggaggctgcggcggcaacaggtcttcctgtgtgcctgatgcat
atgcagggattgccaagaaccatgcaacatacgccgcattatgacgacgtggtaggtgag
gtttcggcgttttttgagcatcatattgcccgttgtgtcgcagccggtattccgcgcgac
cagttgttgctggatccagggttcggctttggcaagaatctgcagcataattatcggttg
ctggggcacctggaagaattacatcgcttcggtttgccgttgctggttggtatgtccaga
aaaaccatgattgggcaattgctgggtgttccgccgctcgaacgggttcatggcagtgtc
gcatgcgcggttattgccgctatgaagggtgcccatattatccgtgtccatgatgtgaaa
gcgacggtggatgcaatacgtgtagtcgaagcaactctatcagcgaaggaataa

DBGET integrated database retrieval system