KEGG   Dickeya solani IPO 2222: A4U42_12860Help
Entry
A4U42_12860       CDS       T04410                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dso  Dickeya solani IPO 2222
Pathway
dso00473  D-Alanine metabolism
dso00550  Peptidoglycan biosynthesis
dso01100  Metabolic pathways
dso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4U42_12860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4U42_12860
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A4U42_12860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dso01011]
    A4U42_12860
Enzymes [BR:dso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4U42_12860
Peptidoglycan biosynthesis and degradation proteins [BR:dso01011]
 Precursor biosynthesis
  Amino acid ligase
   A4U42_12860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK GARS_A PTS_2-RNA
Motif
Other DBs
NCBI-ProteinID: ANE76140
LinkDB All DBs
Position
complement(2974899..2975999)
Genome map
AA seq 366 aa AA seqDB search
MSKIRVGVVFGGKSSEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKQGEWHVNDASNYLLN
ADNPALIALNRSSQNVALIPGQTHHQLIDTASASALSQIDVIFPIVHGTLGEDGSLQGLL
RMANIPFIGSSVLGSAVSMDKDVTKRLLRDAGLLVAPFVTLTHANRARHPYDSITAQLGL
PLFVKPANQGSSVGVSKVRDQAEFERAVDLAFRYDHKVLVESAIVGREIECAVLGNDYPK
ASVCGEIVLHDEFYSYDTKYINEDGAGVAIPAAMDDGVHQHIRDIALRAFQTLDCQGMAR
VDVFLTPDQQVVVNEVNTLPGFTNISMYPKLWEASGLGYTALITQLIELALERHAQDSNL
QSSVRA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattcgggttggcgtggtttttggtggtaaatcctctgagcacgaagtgtca
ctgcagtccgcaaaaaacattgtggacgccattgataaaacgcggttcgatgtggtgttg
ctgggcatcgacaagcaaggggaatggcacgtcaacgacgcctccaactacctgctcaac
gccgacaacccggcgctgatcgccttaaaccgctccagtcaaaacgtggcgctgattccg
gggcaaacccaccatcagttgatcgacaccgccagcgccagcgcgctgtcgcagattgac
gtcattttcccgatcgttcacggcacgctgggcgaagacggttcgctgcaagggttactg
cgcatggcgaatattccgtttatcggcagcagcgtgctgggttctgccgtcagcatggac
aaagacgtcaccaagcggttgctgcgcgacgccggcctgctagtggcgccgttcgtcacc
ctgacccacgccaaccgcgcccgccatccctacgacagcataacggcgcaactgggcctg
ccgctgttcgtcaaaccggccaatcagggctcttccgtcggcgtgagcaaggtgcgcgat
caggcggaattcgagcgggcggtggatctggcgttccgttacgaccacaaagtgctggtg
gagtcggcgattgtcggccgtgaaatcgaatgcgcggtgctgggcaacgactacccgaaa
gccagcgtctgcggcgaaatcgtgctgcacgacgagttctactcctacgacaccaaatac
atcaacgaagacggcgcgggagtagcgattccggcggcgatggacgacggggtgcaccag
catatccgcgatatcgccctgcgggcgttccagacgctggactgccagggcatggcgcgg
gtagacgtgtttctgacgccggaccaacaggttgtcgtcaacgaggtcaacaccctgccc
ggtttcaccaacatcagcatgtacccgaaactgtgggaagccagcgggcttggctatacc
gctctgatcacccaattgattgaactggcgctggagcgccacgcgcaggacagcaatctg
caaagctcggtgcgcgcatga

DBGET integrated database retrieval system