KEGG   Dickeya solani IPO 2222: A4U42_13510Help
Entry
A4U42_13510       CDS       T04410                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
dso  Dickeya solani IPO 2222
Brite
KEGG Orthology (KO) [BR:dso00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    A4U42_13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ANE76260
LinkDB All DBs
Position
complement(3120964..3121692)
Genome map
AA seq 242 aa AA seqDB search
MSYILILLLGLFAGSVSGIVGTGGSIILLPALAWAFSPQAAVPIMAIAATMSNISKVILW
RNAINLRALGCYCLPGIPASIIGASLLWAMPVRLSSLCIGLFFLLLIPLRHLARQRAFSL
NDSQLAVAGGVVGFLTGVVFSTGPLTLPLFAGYGLLKGALLATESAASLVIYLTKASTFG
VVGALPLSVLWAGLMVGLTQVAGVYIGKRFVLRLSDTLFNRLVDSMMLIAGLSLLWETLP
AH
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgagctatatcctgattcttcttctcggcctgttcgccggcagcgtcagcggcatcgtc
ggcaccggcggctccatcattctgctgcccgcgctggcctgggcattcagcccgcaggcg
gcggtgccgatcatggcgatcgccgccaccatgagcaacatttccaaagttatcctgtgg
cgtaacgccatcaacctgcgggcgctgggttgctattgcctgcccggcatcccggcgtcg
ataatcggcgccagtctgctgtgggcgatgccggtacgcttgtccagcctgtgcatcggt
ctgttttttctgctgctgatcccgctgcgccatctggcccggcagcgcgccttcagcctg
aacgatagccaactggcggtggcgggcggcgtggtcggcttcctcaccggcgtggtgttt
tccaccggcccgctgacgctgccgctgtttgccggttacggtctgctgaaaggcgcgtta
ctggcgaccgaatccgccgcgtcgctggtgatctatctgaccaaagcctctaccttcggc
gtggtcggcgcgctgccgctgtcggtattgtgggccgggctgatggtcggactgacgcag
gtggccggggtgtatatcggcaaacgcttcgtactgcgtctgtccgacaccctgttcaac
cggctggtggacagcatgatgctgatcgccggtctgtcgttgctgtgggaaacgctgcct
gcgcattag

DBGET integrated database retrieval system