KEGG   Dickeya solani IPO 2222: A4U42_19855Help
Entry
A4U42_19855       CDS       T04410                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dso  Dickeya solani IPO 2222
Brite
Enzymes [BR:dso01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A4U42_19855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANE77400
LinkDB All DBs
Position
4615847..4616371
Genome map
AA seq 174 aa AA seqDB search
MKLKALILSSLFVSAIAGAASTTVTLKEALPTGDGDTLGDITITETEYGLLFSPSLKGLP
PGIHGFHVHANASCAPGEQNGNKVPALAAGGHLDPLKTGRHLGPYNDKGHLGDLPGLVVN
ADGTASYEVLAPRLKSLSEVKNHALMIHTGGDNYADTPKELGGGGMRIACGVIQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaagcattgattctgtccagcctgttcgtcagcgcgatagccggcgcagcc
agcaccacggtaacgctaaaagaggcgctgccgaccggagacggcgatacgcttggcgat
atcaccatcaccgaaacagaatacggtctgctgttcagccccagcctgaaaggattgccg
ccgggcattcacggcttccacgtgcatgccaacgccagctgcgcgccgggcgagcagaac
ggcaacaaggtgccggcattagcggccggcggccatctggatccactaaaaaccggccga
catcttggcccttacaacgacaaagggcacctcggcgacctgccggggctggtggtcaat
gccgatggcaccgccagttacgaggtgctggcgccacggctaaaatcgctatcggaggtg
aaaaaccacgcgctgatgatccataccggcggcgataactacgcggatacgccgaaagag
ctgggcggcggcggcatgcgtatcgcctgcggcgttattcaataa

DBGET integrated database retrieval system