KEGG   Dichomitus squalens: DICSQDRAFT_105020Help
Entry
DICSQDRAFT_105020 CDS       T03133                                 

Definition
(RefSeq) glycosyltransferase family 15 protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
dsq  Dichomitus squalens
Pathway
dsq00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    DICSQDRAFT_105020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dsq01003]
    DICSQDRAFT_105020
Enzymes [BR:dsq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     DICSQDRAFT_105020
Glycosyltransferases [BR:dsq01003]
 Glycan extension
  Yeast mannan chain
   DICSQDRAFT_105020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 18833559
NCBI-ProteinID: XP_007365169
JGI: 105020
UniProt: R7T0E2
LinkDB All DBs
Position
Unknown
AA seq 306 aa AA seqDB search
MLVRNSELEGALRSVTQLEDRFNHRFGYPWIFLNEVPFTDEFKEKMSAAIAGPVSFGLIP
KEDWYQPGWIDEEKAAASRAQMEANNVVYGGSVSYRNMCRFNSGFFYRHPLAQRYKWYWR
VEPGVSFHCDTDYDPFLFMEEHDKVYGFTISLQEWPPTVPTLWDAVKEYIAANPQHVAPN
NSMAFLSDDGGNSYNMCHFWSNFEIANMEFWRGEVYSKFFEHLESKGGFYYERWGDAPVH
SIGAALFARKDQIHFFDDIGYQHPPFMHCPRLHSVRQERNCSCTQYQSFDNNMYSCLRKW
EQVVRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgcgcaactcagagctagaaggtgccttacggagcgtcactcagctcgaagac
cgcttcaaccatcgatttggctatccttggatttttctgaacgaggtcccgttcactgac
gagttcaaagaaaagatgagcgccgccattgccggaccagtctcctttggactgatcccg
aaggaagactggtatcagccaggctggatagacgaggagaaagctgctgcgagtagagct
cagatggaagccaacaatgtcgtatacggaggcagcgtctcctatcgtaacatgtgccgc
ttcaactccggcttcttctacaggcatcctctcgcgcaacgctacaagtggtattggcga
gttgaacctggtgtcagcttccactgcgataccgactacgaccctttcctcttcatggaa
gagcatgacaaggtctatggctttaccatctctctacaagagtggccaccaacagttccg
acgttgtgggatgccgtcaaagaatacatcgctgcgaacccgcaacatgtagctcccaac
aactccatggccttcctctccgacgacggcggcaactcttataacatgtgtcacttctgg
agtaatttcgagatcgcgaacatggagttttggcgcggtgaggtgtacagcaagttcttc
gagcacctggagtccaagggcgggttctattacgagcgctggggcgacgcccctgtccac
agcatcggcgccgcgctctttgcccgcaaagaccagattcacttcttcgacgacatcggg
tatcagcacccgcccttcatgcactgtccgcgcctccacagcgtgcggcaggaacgcaac
tgctcgtgcacgcagtatcagagcttcgacaacaacatgtactcctgcttgcgcaagtgg
gagcaagtggtgcggtcgtga

DBGET integrated database retrieval system