KEGG   Dichomitus squalens: DICSQDRAFT_109558Help
Entry
DICSQDRAFT_109558 CDS       T03133                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
dsq  Dichomitus squalens
Pathway
dsq00500  Starch and sucrose metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICSQDRAFT_109558
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DICSQDRAFT_109558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 18833854
NCBI-ProteinID: XP_007368396
JGI: 109558
UniProt: R7SRU7
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MLRFLVLLLFITSVFAATADQWRSRTIYQLLTDRFATTDGHDPHCNATARQYCGGTWKGI
INKLDYIQDLGFDAVWISPVVANIEGNTSYGEAYHGYWTRDMTALNPHFGDASDLQALSA
ELHRRNMLFMVDIVVNHMASASDPPDYNIYQPFSSQSSYHTECFIQDWQNQTNVEQCWLG
DTSVPLVDLNTEDDDVVNTLNAWVKDLVTTYSIDGLRVDTVRHIRQDFWPGFADAAGVFI
LGEVQHPNTSYVADYTHKIDGVLDYPTWYSLVPAFTNTSGNITDLARKVWEAQAQYKTGE
LLVGSFLENHDNPRLPSFIQDNALIKNAITWPFMNDGIPILYQGQEQTYAGGDDPENREA
LWLSQYIQQRPLVTHVKILNAARRAAMAYNANFLKTPAMLFAVSQKTLAISKPPLLTLLT
NVGSSSTPNWNVPDAGYKPGETLVDVLTCNTITVDKNGGVIVAGHAGNPQVLLPASALSP
KGTMCSNIATGTGEHQVSSATHNTPGGGDDLRSQIGWAMSLAIPLTLLFLASQTTLFLG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtttcctcgtcttgttgcttttcatcacttccgtcttcgccgcgactgccgat
caatggcgcagcaggaccatctaccaattactcacggatagattcgcgaccaccgacgga
catgaccctcattgcaacgccactgcacgtcagtactgtggaggaacgtggaagggaatc
atcaacaagctcgactacatccaagacctcggcttcgacgcagtctggatttctcctgtc
gtcgcgaacatagaaggaaacacgtcctacggagaagcgtaccacggatattggacacgg
gacatgactgccctcaacccgcacttcggcgacgcgagcgacctgcaagcgctcagcgcc
gagttgcaccggcgcaacatgctcttcatggtcgatatcgtcgtcaaccacatggcgtct
gcctccgatcccccagactacaacatctaccagcccttctcgtcacagtcgtcctatcac
accgagtgcttcattcaagactggcagaaccagaccaacgtcgaacagtgctggctcggg
gacacgtccgtgcctttggtggacctcaatacggaggacgacgatgtcgtgaacacgctc
aatgcgtgggtaaaggacttggttaccacgtactcgatcgacgggcttcgtgtcgatact
gtcaggcatatccggcaggacttctggcctgggtttgcagacgccgctggggtgttcatt
ctgggcgaggttcaacacccaaacacctcttacgtcgctgactatactcacaaaattgac
ggcgtgctcgactaccccacctggtactccctcgtccctgccttcaccaacacatccggt
aacatcaccgatctcgcgcggaaggtgtgggaagcgcaggctcagtacaagacgggagag
ctcctggtcgggtcattcttggagaaccacgacaacccgcgcttaccgtcgttcatacaa
gacaacgcgctgatcaagaacgcgataacgtggccctttatgaatgacggcatacccatc
ctctaccaaggtcaggagcagacttacgctgggggggatgatcccgagaatcgcgaagcg
ctctggctgtcccagtacatacagcaaaggccactagtgacgcacgtcaagatccttaat
gccgcgcgccgagccgccatggcgtacaacgctaatttcctcaaaacgccagcgatgctc
ttcgccgtttcccagaagacccttgcgatctcgaagccgcctctgctcacgctcctgacc
aatgtcgggagcagctccacgcccaactggaacgtgcccgacgcggggtacaagcctggg
gagacgctcgtcgatgtgctgacctgcaacacgatcactgtggataagaacggtggggtc
atcgtcgcggggcacgcgggcaacccacaggtcctgctcccggcgtcggcgttgagcccg
aaggggacgatgtgctcgaacatcgcgacgggcacaggggagcaccaggtttcctcggcg
acgcacaacacgcccggcggtggagacgacttgcgctcgcagatcgggtgggcgatgtcg
cttgcgataccgcttacactgctcttcctcgcgagccagacgactttgtttttaggatga

DBGET integrated database retrieval system