KEGG   Dichomitus squalens: DICSQDRAFT_110398Help
Entry
DICSQDRAFT_110398 CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dsq  Dichomitus squalens
Pathway
dsq00010  Glycolysis / Gluconeogenesis
dsq00051  Fructose and mannose metabolism
dsq00052  Galactose metabolism
dsq00500  Starch and sucrose metabolism
dsq00520  Amino sugar and nucleotide sugar metabolism
dsq01100  Metabolic pathways
dsq01110  Biosynthesis of secondary metabolites
dsq01130  Biosynthesis of antibiotics
dsq01200  Carbon metabolism
Module
dsq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dsq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICSQDRAFT_110398
   00051 Fructose and mannose metabolism
    DICSQDRAFT_110398
   00052 Galactose metabolism
    DICSQDRAFT_110398
   00500 Starch and sucrose metabolism
    DICSQDRAFT_110398
   00520 Amino sugar and nucleotide sugar metabolism
    DICSQDRAFT_110398
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DICSQDRAFT_110398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsq04131]
    DICSQDRAFT_110398
Enzymes [BR:dsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     DICSQDRAFT_110398
Membrane trafficking [BR:dsq04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    DICSQDRAFT_110398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18833912
NCBI-ProteinID: XP_007368959
JGI: 110398
UniProt: R7SQ24
LinkDB All DBs
Position
Unknown
AA seq 496 aa AA seqDB search
MASRRGSQTVQLPSGQTLTTFTKSSTDDEGLPHATKKTMADHLRKFEALFNLTPQRMRMI
VEAFRESLELGLSKNGQIVPMIPTYVFGWPKGDETGNFLAVDLGGTNLRVCLVTLEGKGK
FEITQAKYRLSEEQKQEEGQKLFDFCGGCLKAFVDANQETGLIPKGSILPLGFTFSYPCS
QDRIDHGVLIRWTKGFGAPNTEGHDVVQMFRKSLTKHSVPAEIVALTCDTTGTLIASHYV
NPKTRIACIFGTGCNAAYMEKVKDIPKIAHLGIDPEQEMAINCEWGAFDSFEHENLPRTK
YDQIIDESSNKPGEQAFEKLISGRYLGEILRLIICELIDEGVLFLGQNTYKIEIPYSFDT
AFLSLMEMDPTEELLMIIGIFNHFFALETTLAERQFFRALAKLVGRRAARLSACGIAAIV
SKMGYLEEGCAVGADGSLYNKYPMFPERVHEGLQDIFGEKGKNIVTYRAEDGSGIGSAIV
AAMTKARKDAQIYPTL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggctagcagacgtggaagccagacggtccagctcccttcgggccagaccctcacgact
ttcacgaaatccagcaccgacgatgaaggactccctcacgcaaccaagaaaaccatggcg
gatcacctccgtaaatttgaggccttgttcaacttgaccccacagcggatgcgtatgatc
gtcgaggcgttcagggagtctttggagctcggcctttcgaagaatgggcagattgttcct
atgatcccgacgtacgttttcggatggcccaaaggtgacgagacaggaaacttccttgcg
gttgatcttggcggcacaaacttgcgtgtctgtctcgtcaccctcgagggcaagggcaag
tttgagatcacccaagcaaagtaccgtctatccgaggagcagaaacaggaagagggccag
aagctctttgatttctgtggagggtgcctgaaagcgttcgttgatgccaatcaggagacg
gggctgatccccaaaggctctattcttcccctcggattcacgttctcatacccgtgctca
caagaccgcatcgaccacggtgtgctcattcgatggacgaagggtttcggtgcgccgaac
actgagggtcatgacgttgtccaaatgttccgcaaatccctcacgaagcactctgtgcct
gcagagattgttgcgctcacgtgtgatacgaccggtacgcttatcgcctcacattacgtg
aatcccaagactcgcatcgcgtgcatcttcggtaccggttgcaacgctgcatacatggag
aaggtcaaggacatccccaagatcgctcacctcgggatcgatcctgagcaggagatggct
atcaactgcgaatggggcgcgttcgactcgttcgagcatgagaacctcccgcgcacgaag
tacgaccagatcatcgacgagagctccaacaagccaggcgagcaagcgtttgagaagctt
atctccggtcgttaccttggcgagatccttcggctcatcatctgcgaactcatcgacgaa
ggcgtgctcttcctggggcagaacacatacaagatcgagattccgtattcgttcgacact
gcgttcctttcgctgatggagatggatccgactgaggagctgctgatgatcattggaatc
ttcaaccacttcttcgcgctcgagaccacgcttgcagaacgacagttcttccgcgcgctt
gcgaagctcgtcgggaggcgcgcagcgcggctgagcgcgtgcgggatcgcggcgatcgtg
agcaagatgggatacctggaggaaggttgcgcggtcggcgcggatggatcgctgtacaac
aaataccccatgttcccggagcgggtgcacgaaggcctgcaggacatcttcggcgagaag
ggaaagaacatcgtcacgtatcgtgcagaggacggcagcggtatcggcagcgcgatcgtc
gctgcgatgaccaaggcccggaaggacgcccagatttaccccaccctataa

DBGET integrated database retrieval system