KEGG   Dichomitus squalens: DICSQDRAFT_110931Help
Entry
DICSQDRAFT_110931 CDS       T03133                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dsq  Dichomitus squalens
Pathway
dsq00052  Galactose metabolism
dsq00500  Starch and sucrose metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DICSQDRAFT_110931
   00500 Starch and sucrose metabolism
    DICSQDRAFT_110931
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DICSQDRAFT_110931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18833951
NCBI-ProteinID: XP_007369267
JGI: 110931
UniProt: R7SP98
LinkDB All DBs
Position
Unknown
AA seq 898 aa AA seqDB search
MYPRTALKFALLAQLAFLASATYSDPKVLDACPGYKAKNVLDLGHKLTADLVLAGTACNV
FGNDTEKLKLEVTYESQDRIHVKITDPTENRYEVPEEVLPCPSANLFAGPLTSNIRFNYT
TSPFSFSIYRSKTHEVLFSTASHPIIFEPQYLRVKTNLPANANIYGLGEHTDTFRLPTHN
YTRTLWSRDAYGVPHGENLYGNHPIYYEHRTTGTHGVFLANSNGMDIKLNDTEGTGTTLE
YNVIGGVLDFYFLAGSESDPTEVARQYAEIVGNPAEVPYWSFGLHQCRFGYQNYIDVSEV
ITNYSAAGIPLETMWTDIDYMDRRRIFTVDPDYFPLDRMREIVDYLHSHDQKFVLMTDPA
VAYAPGEGYGPFDRGTTADIWLKAANGSSPFLGAVWPGVTVFPDWFNPKTQDYWTNEFQS
FYSPDTGLDIDGAWIDMNEPSSFCNYPCTDPFEQAREQALPPARTSPPPDPDAPIFGEAP
PSKRKRASAPDHSGDNVQSPPYAIANFAGAGPLSDKTAYTDAVHANGLIEYDTHNLYGTM
MSTATHEAMLARRPGLRTLVITRSTFAGAGAKVGKWLGDNFSDWDHYKQSIAGILGMAGV
YHVPMVGADICGYAENTTETLCARWALLGAFYPFMRNHNADTSISQEFYRWPLTTQAAKN
ALDVRYRLIDYLYTAFHQAKTDGTPVLRPLWYAFPKDTNTFGIDTQFLFGPSVLVSPVID
ENSTTVDVYYPKEFFYDFHTLAPITGVGSSVQLTNVNFTTIPVSIKGGAVLPQRASSQST
TTELRKTDFEIVVAPALADGSASGSLYLDDGISITPKTSTSVSFAYNRGKLTVKGSFGYA
TGVNVSRVRFANTKSAPKSVKFNGKAVSADKVAFDSANGVLDVKLGIPFKSNFIVELD
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgtacccccgcacggcgctcaagttcgccttgctcgcacagttggcgttcctggccagt
gcgacgtactcagacccgaaggtgctcgatgcgtgtccgggctacaaggcgaagaacgtc
ctcgaccttggccacaagctcaccgccgacctcgtccttgccggcacagcatgcaacgtc
tttgggaatgataccgagaagttgaagttggaggtcacgtacgagagccaggaccgcatc
cacgtcaaaatcaccgatcctaccgagaaccggtacgaagtgcccgaagaggtcctgcca
tgccctagtgccaacctcttcgctggtcccctaacgtccaacatccggttcaactacacc
acgtcccctttctctttttcgatctaccgctcgaagacacacgaagtcctcttctcgact
gcatcgcaccccatcatctttgagccccagtacctgcgcgtgaagacgaacctgcccgcg
aacgcgaacatctacggcctgggcgagcacaccgacacgttccgcctcccgacgcacaac
tacacgcgcacactgtggtctcgcgacgcctatggcgtgccacacggtgaaaacctatac
ggcaaccacccgatctactacgagcaccgcacgacgggtacccatggcgttttcctcgcg
aattcaaatgggatggacatcaagctcaacgacaccgagggcaccggcacgacgctcgag
tacaacgtgatcggcggcgttctggacttttacttccttgcgggtagcgagagcgacccc
actgaggtcgcgcgccagtacgcggagatcgtgggcaaccccgcggaggtgccgtactgg
tcgttcggtttgcatcagtgccgtttcggctaccaaaattacatagacgtctcggaggtc
atcactaattactcggccgcgggtatccctctcgagactatgtggacagatatcgactac
atggatcgccgccgtatcttcaccgtcgacccggattacttcccgctagaccgcatgcgg
gagatcgtcgattacctccactcacatgaccagaagttcgtgttgatgaccgaccccgct
gtcgcctatgcccctggagagggttacggcccctttgaccgcggtactaccgctgatata
tggctgaaggccgccaatggcagtagtccgttccttggcgctgtctggcctggcgtgact
gtgttcccggactggttcaatccgaagacccaggactactggaccaacgagttccaatcg
ttctacagcccagataccggtctggacatcgatggcgcgtggatcgacatgaacgagccc
tccagcttctgcaactacccgtgcacggaccctttcgagcaggccagggaacaggccctc
ccgcccgcgcgcacctcccctccccccgacccagacgcgcccatcttcggcgaggcgcct
ccgagcaagaggaagcgcgcttccgccccagaccactccggcgacaacgtgcagagtccc
ccatacgcgattgcgaacttcgccggggcgggccctctctcggacaagaccgcttacacg
gacgcggtgcacgcgaacgggctgatcgagtacgacacgcacaacctgtacgggaccatg
atgtcgacggcgacgcatgaggcgatgcttgcgcgtcgccctggactcaggacgctcgtc
ataacgcgctcgacgtttgctggggcgggggcgaaggttgggaagtggcttggagacaac
ttcagcgactgggaccattacaagcagtccattgctggtatcctcggcatggcgggtgtc
taccacgtccccatggtcggtgcggacatttgcgggtatgcggagaacacgacggagacg
ctatgcgcgcgctgggctttgttaggcgcgttttaccccttcatgcgtaaccacaatgca
gacacgtccattagccaggagttctatcgctggccgctgaccacgcaagctgccaagaac
gcgctcgacgtccgctaccgcctcatcgattacctctacaccgccttccaccaggcgaag
acggacggcacgcccgtcctccgcccgctctggtacgccttccccaaggacacgaacacc
ttcgggatcgacacccagttccttttcggcccgtctgtccttgtgtcgcccgtcatcgac
gagaactcgacgaccgtcgacgtatactaccccaaggagttcttctacgacttccacacc
ctcgcgccgatcacgggcgtgggcagctccgtgcagctcacgaacgttaacttcacgacc
atcccggtgtcgatcaagggtggcgctgtgctcccgcagcgtgcgagcagccagtcgacg
acgacagagctgaggaagaccgacttcgagatcgtcgttgcgcctgcgctcgcggatggc
tccgcctcgggctcgctgtacctggacgatggcatttccatcacccccaaaacgagcacg
agtgtgtcgtttgcgtacaaccgcggcaaactcaccgtgaagggctcgtttggatacgcc
accggggtgaacgtctcgcgcgtgcggttcgcgaacacgaagagtgcgccgaagagcgtg
aagttcaacgggaaggcggtcagcgcggacaaggtggcgtttgactctgctaatggggtc
cttgacgtgaagttgggtattccgttcaagtcgaacttcattgtcgagctcgattga

DBGET integrated database retrieval system