KEGG   Dichomitus squalens: DICSQDRAFT_111705Help
Entry
DICSQDRAFT_111705 CDS       T03133                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
dsq  Dichomitus squalens
Pathway
dsq00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dsq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DICSQDRAFT_111705
Enzymes [BR:dsq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DICSQDRAFT_111705
Chromosome and associated proteins [BR:dsq03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     DICSQDRAFT_111705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET Med26
Motif
Other DBs
NCBI-GeneID: 18833994
NCBI-ProteinID: XP_007369795
JGI: 111705
UniProt: R7SNG4
LinkDB All DBs
Position
Unknown
AA seq 866 aa AA seqDB search
MSTMTELRIESKASAALLFESDAVKAESLEFGIIKDEEMLDLSTSTTVKEDSVEPDMSRS
TSVEMKLEDDSSKSATPLLPAKSKSKPGKAPVQLIGHLPRAEEEAMTTFVEIPNNHYQYG
TLGKSREALESMTCDCQYEHGVDDPDMACGLSSDCINLMTQVECLPDDCRCRGYCRNQRF
QRKQYAPIEIVKTEMKGFGLRAAADIPKDTFIYEYVGDVVSQPSFIKRMRQYAEEGIRHF
YFMMLQKDEFIDATKRGGIGRFANHSCNPNCYVAKWTVGSHVRMGIFANRVIKKDEELTF
NYNVDRYGHEAQPCYCGEPNCVGYIGGKTQTDLAAMDDLYLDALGITDEVEMYGLKGSKK
KKGKKLDEDFIPDLKPIVLKDVPKVVSAMRQTQSKKVLVKLLTRIKLTEDLAALRQIMRL
RGFSLMTNVLEDHSQDVEIQTLALECMSTWPLIQRNKVEDSKINVPVEILAQSDNEGLAT
LAKKLLAQWETLEYAYRIPKRVKGDNDDAPAEQVIVFNYDEDERPSKRSRPEDDFPKFVL
PSFSRPRPKTPPPIQYVVEPNSYQKTMMQRQVEARKQQEIADIIAKAAKAAEEASKPKPA
PQAATVDSLFGLLPKREPIRDWDRKKKSSSSSPKHKKPHQSKEEKEANKEKRLLKLIGAV
VVKCMSKYKDQMDHEHFKKYAKELTHIIAEKEKKSQSYKDGKLDSLSEEKTTKIKKFAKD
YIAKILRKLEKSGKRRKPVSTAGSSSTPDSRADNDDAVVAAATVDEVMGFDPNDDGDDND
GLELNGHDEHDDVKDDHHREDDGPSGSGSPEDAASGSGQTSPTLVCDPRLRLDSECDKLD
SQLKPTSQPYYTKPKVHCENVHDASW
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccatgacggagcttcggatcgagagcaaagcttccgctgctctgctcttcgag
tcagacgccgtcaaagccgaatccttggagttcgggatcatcaaggacgaggaaatgcta
gacttatctacgtcgaccaccgtcaaggaagacagtgtcgaaccagacatgtctcgcagc
acatccgtagaaatgaagctggaggatgattcctccaagtctgccactccgttgttgccc
gccaagtccaagagcaaaccaggcaaagcccccgtccagttgattggtcacctaccacga
gcggaggaagaagctatgacgaccttcgtggagatccccaacaaccactatcaatatggt
acgctaggaaagtcgagggaggccttggagagcatgacgtgtgattgccagtacgagcat
ggcgtcgacgaccccgatatggcttgtggtctcagctccgactgtatcaacctcatgacc
caggtggaatgcctgccagatgactgtcggtgtagaggctactgtcggaatcagcggttc
cagcgcaagcagtacgcaccaatagagatcgtcaagacagaaatgaaggggttcggcctg
cgtgctgcggcggatatacccaaggatacattcatctatgagtatgtgggtgatgtcgtg
agccaaccttcgttcatcaagcgaatgcgccaatatgcggaggaaggtatacgacacttc
tacttcatgatgcttcaaaaggacgagttcatcgacgccaccaagcgcgggggtatcggc
cgattcgccaaccacagctgcaacccgaactgctatgtggcgaagtggaccgtcggcagt
cacgtccggatgggcatctttgccaatcgcgtgatcaagaaggacgaggagctgacgttc
aactacaatgtggacagatatggtcatgaggcgcaaccgtgctactgtggcgaacccaat
tgtgtcggctacattggcggaaagacccagacggatcttgctgcgatggacgacttgtac
ctggatgctctcggtattactgacgaggtggagatgtatgggctcaagggatcgaagaag
aagaagggcaagaagctggatgaagacttcatccctgatctcaagccaatcgtcctcaaa
gacgtgccgaaggttgtatcggctatgcgtcagactcaaagcaagaaggtcttggtcaag
ctgctgactcgcatcaagttgacggaggacctcgctgcgcttcgtcagatcatgcgtttg
cgagggttcagtctgatgacgaacgtcctcgaggaccatagccaagatgtcgagattcag
actctggcgttggagtgcatgtcgacttggccgcttatccagcggaacaaagtagaagat
tctaagatcaacgtacctgtggagatcttggcacaatccgacaacgagggtctggcgacg
ttggcaaagaagctgctggctcagtgggaaacgcttgagtacgcttaccggatacccaag
cgcgtcaagggcgacaacgacgatgcgccagcggagcaggttatcgtcttcaactacgac
gaagatgaacggccatcgaagcggtcacggccagaagacgactttccgaagttcgtcctc
ccttccttctcgaggccacggccgaagacgccgccgccgattcaatacgtcgtcgagcca
aattcgtatcagaagacgatgatgcaacgccaagtcgaggcgcggaaacagcaggagatt
gcggacatcatcgcgaaagcggccaaggccgcggaggaggcgagtaagcctaagccggcg
ccccaggcggctactgtggactcgctattcggcctcctaccgaagagagagcctatcagg
gactgggacaggaagaagaagtcttcgtcgtcgtcacccaaacacaagaaaccgcaccag
tcaaaggaggagaaggaggcgaacaaggagaagaggctgctgaaattgattggtgcggtt
gtcgtgaagtgcatgtccaagtacaaggaccagatggaccacgaacacttcaagaagtat
gcgaaggagctcacgcacatcatcgccgagaaggagaagaagtcgcagagctacaaggac
ggcaagctggactctctatcggaagaaaagacgaccaagatcaagaaattcgcgaaggac
tacattgcgaagattctccgcaaactcgagaagtcgggcaagcgacggaaaccggtctcc
actgctggctcttcctcaacaccagacagtcgcgcggataacgacgacgccgtcgtagca
gctgctactgttgacgaggtcatgggcttcgaccccaacgacgatggcgacgacaatgac
ggcctcgagctcaatgggcatgatgagcacgatgacgtgaaagacgatcatcatcgagaa
gatgatggcccttcggggtcaggcagcccagaagacgcggccagtggttcggggcagacg
tcgccgacactcgtctgcgatcctcgattacgattggactcggaatgtgacaagttggac
tcgcaactgaagccaacgtcacagccgtattacacgaagccgaaggttcactgcgagaat
gtgcacgatgcatcatggtag

DBGET integrated database retrieval system