KEGG   Dichomitus squalens: DICSQDRAFT_125666Help
Entry
DICSQDRAFT_125666 CDS       T03133                                 

Definition
(RefSeq) glycoside hydrolase
Organism
dsq  Dichomitus squalens
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20 Alpha-amylase_C Alpha-amylase FapA
Motif
Other DBs
NCBI-GeneID: 18834299
NCBI-ProteinID: XP_007363674
JGI: 125666
LinkDB All DBs
Position
Unknown
AA seq 572 aa AA seqDB search
MANWLKLSVFATLGALFTTTEGRPFLSSASTGNSLASRAPSSNKTVIVQMFEWTWDSVAS
ECTNFIGPAGYGFVQVSPPQEHVTGDQWWTDYQPVSYILTSKRGNRDQFASMISTCHAAG
VGVIVDTLWNHMTGSDSGTGVAGSSYTHYNYPGIYQNQDFHHCGLEPGDDIVNYDNRLEV
QTCELDNLADLATNTTYVQGRLAEYGNDLLSLGADGFRLDAAKHIAATDLAQILSQLNSK
PYITQEVIFGEGEPITPNEYVGNGDVQEFRYTTALKNAFLGGGISSLESFDNLGWVDGSV
ANVFVTNHDTERNGNSLNNNSPSNTYVTATIFSLAHPYGTPTILSSYDGFTNTDAGAPNG
GTGTCSGTGGENGWLCQHRWVAFTGMVGFRNNVGDAEVTNWVSPQSEQIAFGRGALGFVA
INNADSDWSATFSTSLPSGSYCDVISGSSSGSTCTGSSFTVSGGSFTATVPARSAIAIHT
GQKGTGSSSGSGGSGNVVVNFAENATTTFGENIFVVGSISQLGNWDPASAIALSSASYPV
WTASVSIPAGTSFEFKFIRKETDGSTLTTSWR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactggctcaagctctccgtattcgctaccctcggtgcactattcactactacc
gaggggcgacctttcctctccagtgcgagtaccggaaactccttagctagtcgcgcgccg
tccagcaacaagaccgtcatcgtccaaatgtttgagtggacatgggacagtgttgcttcc
gagtgcaccaacttcatcggtcctgccggctacggtttcgtgcaagtgagcccgccgcag
gagcacgtcacgggcgaccagtggtggacagactaccagcctgtctcttacatcctgacg
tccaaacgcggcaaccgagaccagttcgccagcatgatttcgacctgtcatgccgcgggc
gttggtgtgatcgtcgacaccctctggaaccatatgaccggcagcgacagcggcaccggc
gtcgccggctcttcgtacacccactacaactacccggggatctaccaaaaccaggacttc
caccactgcgggcttgaacccggcgacgacatcgtcaactacgacaaccgcctcgaggtg
cagacgtgcgagcttgataacctcgccgatctcgcgacgaacaccacgtatgtgcaaggc
cgactcgcggaatacggcaacgatctgctatcgctgggcgcggatggttttcgcctcgac
gcggccaaacacatcgctgctacggatctcgcacaaatcctgtcgcaattaaacagcaag
ccgtacatcacgcaggaggtcatcttcggagagggcgagcccatcacgcccaacgagtat
gtcggaaacggggatgtccaagagttccgttacaccacggcgctgaagaatgcattcttg
ggcggaggcatctctagcctggagagctttgacaatctaggctgggtggatggctccgtg
gcgaatgtcttcgtgaccaaccacgatacggagcggaatggcaactccctcaacaacaac
tcgccgtccaatacctacgtcactgcaacgatcttctccctcgcacacccgtacggcacg
ccgaccatcctgtcgagctacgacggtttcacgaacaccgacgccggtgcacctaatggc
ggcacggggacatgctctgggactggtggcgagaacggctggctctgccagcaccgctgg
gtcgccttcacgggcatggtcggcttcaggaacaacgtcggcgacgcggaggtgacgaac
tgggtgtcgccgcagtcggagcagattgcgttcggacgtggcgccctcggcttcgtcgcg
atcaacaacgccgactcggactggtcggcgacgttctcgacatctcttccgagtggttcc
tactgcgacgtcatcagcggctcgtcttcaggcagtacctgcacaggtagctccttcacc
gtctcaggtggctcgttcaccgccaccgtccccgcccgcagcgcaatcgccatccacaca
ggacagaagggtaccggctccagctctggcagcggcggttccggtaacgtcgtcgtgaac
ttcgccgagaacgccactacgacgttcggtgaaaacatctttgttgtcggcagcatctcg
cagctcgggaattgggatccggccagcgcgatcgcgttgtcgtcggcttcgtaccccgtg
tggacggcttccgtgagcatcccggcaggaacctcctttgaattcaagttcatcaggaaa
gagactgacggaagcacactcaccacgtcgtggagatga

DBGET integrated database retrieval system