KEGG   Dichomitus squalens: DICSQDRAFT_134993Help
Entry
DICSQDRAFT_134993 CDS       T03133                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dsq  Dichomitus squalens
Pathway
dsq00500  Starch and sucrose metabolism
dsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICSQDRAFT_134993
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DICSQDRAFT_134993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18835263
NCBI-ProteinID: XP_007364090
JGI: 134993
LinkDB All DBs
Position
Unknown
AA seq 574 aa AA seqDB search
MRFSLLTSLAALAVGAYAQSSSVDAYVASESPAAKAGLLANIGPSGSKASGAKAGVVIAS
PSTSNPNYLYTWVRDSSLVFKTIIDQFTTGEDTSLQGLIDQFTTAESILQQTSNPSGSVS
TGGLGEPKFNIDETAFTGSWGRPQRDGPALRSTAIITYANWLLANGNGTSYVQNTLWPII
KLDLDYVQNNWNSSTFDLWEEINSSSFFTTAVQHRALRQGAAFANAVGQSSVADGYTTQA
DNLLCFLQSYWNPSAGYVTSNTGGGRSGKDSNSVLASIHTFDVDAGCDAATFQPCSDKAL
SNLKVYVDSFRSVYSINIGIASNAAVAVGRYPEDVYFNGNPWYLSVFAVAEQLYDALITW
DKQGSLQVTSTSLAFFQQFDSSVTTGTYGSSSSTYSTLTASIKNFAEGFLAINAKYTPSN
GGLSEQFDKSTGSPLSAADLTWSYASALTAFAARSGKTYASWGASGLTVPSQCNGNAGPT
VSVTFNVDATTVFGENIYITGSVPALQDWSPDTALLLSSANYPTWSITVTLPASTVIEYK
YIRKNNGQVTWESDPNNSITTPASGAVTQNDSWR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttctctcttctcacgtcgttggcggctctcgcggtcggtgcgtatgcccaatcc
tcctcggtggacgcgtacgtcgcgtccgagtcccctgcggccaaggcggggcttctcgcc
aacatcggcccgagcggttccaaggctagcggggcgaaggcgggtgtggtcattgcgagc
cccagcacatcaaatcccaactacctgtacacctgggttcgcgactcgtctctggtattc
aagactatcatcgaccagttcaccactggagaggacacgtcccttcagggtctgattgac
cagttcaccacggcggaatctatcctacagcagacgtctaatccatcaggctcggtcagc
actgggggtctcggagagcctaagttcaacatcgacgagactgcattcaccggctcgtgg
ggccgtcctcaacgtgatggtcctgccctccggtcgaccgctatcatcacatatgcaaat
tggctgcttgcgaacggaaatggcacgagctacgtccagaacacactgtggccgatcatc
aagctagacctcgattacgtccaaaacaactggaactcgtcgacttttgacctttgggaa
gagatcaactcgtcatccttcttcacgactgcggtacagcaccgggcgctccgtcagggt
gcggcatttgccaacgcggttggccagtcatcggtcgccgatggctacacgactcaggca
gacaaccttctatgcttccttcagtcgtactggaacccaagcgctggttacgtgacttcg
aatactggcggtggacggtctggcaaggactcaaactccgtcctcgcttcaattcatact
tttgacgtcgacgctggttgcgatgctgcgaccttccagccgtgctcagacaaggcgctc
tccaacctcaaggtttacgtcgactccttccggtccgtatacagcatcaacattggcatc
gcatccaatgctgctgttgccgtgggtcgctaccccgaggatgtctacttcaatggcaac
ccctggtatctctccgtattcgccgtcgccgagcaactgtacgacgctctcattacttgg
gacaagcaaggctccctccaggtcacctcgacgtcgctcgctttcttccaacagttcgac
tcctcggtcactactggcacctacggctcctcctcctcgacctatagtacactcactgct
tccatcaagaacttcgccgagggcttcctagcgatcaatgctaagtacacaccctcgaac
ggcggtctttcggagcagtttgacaagagcaccggctcgcccctttccgccgccgatctt
acttggagctacgcgtccgcgctcacggcgttcgccgctcgctctggcaagacgtacgcg
agctggggtgcgtccggcttgacggtaccctcgcagtgcaatggcaacgccggccccact
gtttccgtcaccttcaatgttgacgcgacgacggtcttcggggagaacatatacattacc
ggcagcgtccccgctctccaggattggtcgcccgacacagcgctcctgctctcctctgcg
aactatcccacgtggtccatcacggtgacccttcctgcgtcgaccgtcatcgagtacaag
tatatccggaagaataacggccaggtcacatgggagtctgaccctaacaactcgatcacc
acgcctgccagtggggcagtcactcagaacgactcctggcggtga

DBGET integrated database retrieval system