KEGG   Dichomitus squalens: DICSQDRAFT_153858Help
Entry
DICSQDRAFT_153858 CDS       T03133                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
dsq  Dichomitus squalens
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dsq03036]
    DICSQDRAFT_153858
Enzymes [BR:dsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     DICSQDRAFT_153858
Chromosome and associated proteins [BR:dsq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     DICSQDRAFT_153858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18837315
NCBI-ProteinID: XP_007363856
JGI: 153858
LinkDB All DBs
Position
Unknown
AA seq 596 aa AA seqDB search
MTRTAVFLQKACLQHRYIRSRDSSNIVERPERLRAINIGLAAAIARLEEHPCETVSRGPS
KQEQDADELSEAFGELQLTTASRADSLSLSRVPISVVQSEASVDILSHAAVKFVHGDIER
DVYLQNLKRWALESRDKVNKGESEIPEGYSQGDLYLCPGSFDAIRGSLGTICEAVDTIVG
TSQSTLGSSDGANKPSRAFVAVRPPGHHCGENTPSGFCFVNNVAVGAAHAHLRHNINRVV
ILDIDLHHGNGTQSIAWQINEETYRRRLEVEGGAPLGKPGLQIYYGSIHDILSYPCEDGK
PELVQAASISIHGPHGQHIENVHLRPYTSAQDFWDNLYTGPYSRLIKKAGEFIDNTGGAG
EDVLVFISCGFDACEHEFASMSRHQRKVPVSFYHRFARDVGAFAERYAKGRLISVLEGGY
SDRALTSGAMAHLAGLVDNGDSGVDESWWNLENLVALEAATKKRRRGRASPTGPSPPWLA
RALELFTSIDSSHTLGPLPRAPVPASDRTLRERKPGSSSGRPSPATSPGRKSASAKSGAA
RRRLNAAATSASSASDESDLTDVSNGPASEKEAEGEPAAPKKLPRVILKLGPAPPT
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgactcggacggcagtttttctgcagaaggcgtgtcttcagcaccgttacatacgatcg
cgagacagttcaaacatcgtcgaacggccggaacgactccgcgccatcaacattggtctt
gccgcggccatcgcgcggttagaggagcatccgtgcgagactgtgtctcgcggcccctcc
aagcaagaacaggacgcggacgagctatccgaagcctttggggaactccagcttaccacg
gcatcgcgcgctgattcactttcactttctcgtgtcccaatatcggtcgtccaaagcgaa
gcgtctgttgatattctgagccatgcggccgtcaagttcgttcatggagatatagagcgt
gatgtatatctccagaatctgaagcgttgggctctcgagagccgggacaaggtgaacaaa
ggcgaaagcgagatacccgaaggttactcacaaggcgacctctatctctgccctggttca
tttgatgccattcgaggctcccttggaaccatctgtgaagcagtcgacactattgtcggg
acttcccaatcgaccttgggaagctcagatggagctaacaaaccatctcgagcatttgtg
gcagtccgtcctccagggcaccattgtggggagaacacaccctctggtttctgttttgtg
aacaatgtggcagtcggtgccgcacatgcgcaccttcgacacaatatcaatcgcgtcgta
atccttgatattgatctacatcatggaaacggaacgcaatctatcgcttggcagatcaac
gaagagacataccgtcgacgactcgaggtggagggtggcgcccccctaggaaagccaggt
ctacaaatttactatggcagcatacacgatatcttatcgtatccttgcgaggacggtaaa
cctgagttggttcaagctgcttccatctctattcacggccctcacggtcagcacattgag
aacgtccacttacggccgtatacctctgcgcaagacttctgggataatctgtacacgggc
ccatactcgcgtcttatcaagaaggcgggcgagtttatcgacaacactggcggagctgga
gaggacgttttggtcttcatcagctgtggcttcgatgcatgcgaacacgagtttgcttcc
atgtcgcggcaccagcgcaaggtcccagtttcgttctatcaccgcttcgcgcgcgatgtc
ggcgcattcgcggagcgatatgccaaaggacggctgatcagtgttctcgaaggagggtac
agcgaccgcgccctaacgagcggcgctatggcgcatctcgccggcctggtcgataacggc
gatagcggcgtcgacgaaagctggtggaacctcgagaatcttgttgctctcgaagccgct
accaagaaacgacgacgcggccgcgcgtccccaaccggaccatctccaccatggctggcg
cgcgccctcgaactcttcacttcgatcgactcctcacacacgctcgggcccctgcctcgc
gcgcccgttcccgcttcggacagaactctgcgcgaacgcaagccgggaagcagcagtggg
cgaccaagtcccgccacgtccccagggaggaagtccgcctccgcgaagtccggagcagca
cgacgccggctgaatgcggcagcgacctccgcctcgtccgcgtcggacgagagcgacttg
acggacgtttcaaacgggcctgcgtccgagaaggaagcggagggcgagccggcggcaccg
aagaagttgccgcgggtgatactcaaactgggacccgcacccccaacctga

DBGET integrated database retrieval system