KEGG   Dichomitus squalens: DICSQDRAFT_165380Help
Entry
DICSQDRAFT_165380 CDS       T03133                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dsq  Dichomitus squalens
Pathway
dsq00250  Alanine, aspartate and glutamate metabolism
dsq00410  beta-Alanine metabolism
dsq00430  Taurine and hypotaurine metabolism
dsq00650  Butanoate metabolism
dsq01100  Metabolic pathways
dsq01110  Biosynthesis of secondary metabolites
Module
dsq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DICSQDRAFT_165380
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DICSQDRAFT_165380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICSQDRAFT_165380
   00430 Taurine and hypotaurine metabolism
    DICSQDRAFT_165380
Enzymes [BR:dsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DICSQDRAFT_165380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18838451
NCBI-ProteinID: XP_007360932
JGI: 165380
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MALSKHLNADRLIQASKDHKAPGAHSSTDHHAVHGYGARYGTEPIPKYRLPSKGTDAEAT
YQLLHDELTLDGNPALNLASFVHTWMPKQADQLMMENISKNLIDQDEYPMTQVIHTRCVS
ILADLWHAPSTQQAIGTATTGSSEAIQLGGLAMKRLWQEKRKAAGKSIHEPGPNIVMGAN
AQVALEKFARYFDVEMRLVPISEESHYRLDPKRAMQYVDENTIGVYVILGSTYTGHYEPV
KEMADLLDEYEARTGNSVPIHVDAASGGFIAPFATPKLEWDFKIPRVVSINTSGHKFGLS
YVGVGWVVWRSKQFLPKDLIFELHYLGSVEYSFSLNFSRPAHPIIAQYFNFVHLGFEGYR
NVALQDLANARLLSRALEKSGLFYVLSDIHRPQTVGALASAAQKTVGINEANVENYSPGL
PVVSFRFTDEFRQQNPDIQQKWVQVLLRAKGWIVPNYELAPDLESVEILRVVVRENLSAV
MIDRLVADIIEIVEGLVKSDTPTHALSKMSSGVTTAEHHHGGLDKGSGSKSSGTYAKQC
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggccctctctaagcacctcaacgccgaccgcctcatccaggcgtccaaggaccacaag
gcgcctggcgctcatagctcgaccgaccaccatgctgttcacggttacggcgctcgctat
ggcaccgagcccattcccaagtataggctcccatccaagggcaccgatgcagaggcaacg
taccaactactccacgacgagctgaccctcgacggcaacccggccctcaaccttgcgtcc
tttgtccacacatggatgcccaagcaagcagaccagctcatgatggaaaacatctccaaa
aatctcatcgatcaggatgagtaccccatgacacaggttatccacacgcgctgtgtttct
atacttgccgacctgtggcatgcgccgtctacccagcaggctattggcacggcgaccacc
ggttcctctgaggctatacagctcggaggtctggccatgaagcgcctctggcaagagaag
cgcaaggccgctggcaagtctatacatgagcccggtccgaacatcgtcatgggtgccaac
gctcaggtcgcgctcgagaaattcgcgcgctacttcgacgtcgagatgcgccttgtccct
atctccgaggagagccactaccggcttgatcccaagagggctatgcagtatgtggacgag
aacacgattggcgtctacgtcatcctcggaagcacatacaccggccattacgagcctgtg
aaggagatggcggacctgcttgacgagtacgaggcccgtaccggcaactctgtgcccatt
catgtcgatgcggcttctggcggtttcatcgcccccttcgctactcccaagctcgagtgg
gatttcaagatcccgcgtgttgtctccatcaacacgtctggccacaagttcggtctctcc
tacgtcggcgtgggctgggtcgtttggcggtcgaagcaattccttcccaaggacctcatc
ttcgagctgcactaccttggctccgttgaatattcgttctccctcaacttctcgcgccct
gcacaccccatcatcgcgcagtacttcaatttcgtgcacttgggcttcgaagggtaccga
aatgtcgcgctccaagatttggcgaacgcaaggctccttagccgcgctctcgagaagagt
ggtctgttctacgttctgagtgacatccaccggcctcagactgtaggtgctctcgcatca
gctgcccaaaagaccgttggcataaacgaggcgaatgtcgagaactactctcctggcttg
cccgtggtatcgttcaggtttacagacgaattccgccagcagaaccccgacatccaacag
aagtgggtccaggtccttcttcgtgcgaagggctggatcgtacccaactacgagctggca
cccgatttggagagcgtggagatcctccgcgttgtcgtccgcgagaacttgagcgctgtt
atgatcgaccgacttgttgcagacatcattgagattgtcgaaggtctcgtgaagtcggat
acccccacccatgcgcttagtaagatgtccagtggtgtcacgaccgccgaacatcatcat
ggtgggctggacaaaggctctggaagcaagtccagcggcacgtacgctaagcagtgctaa

DBGET integrated database retrieval system