KEGG   Dichomitus squalens: DICSQDRAFT_168177Help
Entry
DICSQDRAFT_168177 CDS       T03133                                 

Definition
(RefSeq) DAO-domain-containing protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dsq  Dichomitus squalens
Pathway
dsq00564  Glycerophospholipid metabolism
dsq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DICSQDRAFT_168177
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DICSQDRAFT_168177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored GIDA NAD_binding_8 Sigma70_r3 Lycopene_cycl 3HCDH_N Pyr_redox FAD_binding_3 Pyr_redox_3 HI0933_like Thi4
Motif
Other DBs
NCBI-GeneID: 18838807
NCBI-ProteinID: XP_007363845
JGI: 168177
LinkDB All DBs
Position
Unknown
AA seq 762 aa AA seqDB search
MLRKLVNRRTIAAVSGATAVVAAGGYYYLNSGPTYPPSTKESRRPPPLWTPPSREQMLDA
LRASARDPHQEFDLLVVGGGATGAGVALDAASRGLKVALVERDDFSAGTSSKSTKLVHGG
VRYLQKAVMELDYEQYKLVVEALHERRIFLQTAPYLSHMLPIMLPIYKYWQVPYYWVGCK
MYDLLAGKENMESSYLMSKGKALEAFPMLKQDGLVGALVYYDGQHNDSRMNIALIMTAVQ
HGAIVANHVEVTSLDKSSASGKLQGARVRDTLTGNEWDVKAKGVINATGPFSDALLTMDD
PNHKPIVQPSSGTHITLPNYYSPRTMGLLDPATSDGRVIFFLPWQGNTIAGTTDTPSEVA
EHPRAQEDEIRWILEEVRRYLSPDIKVRRGDVLSAWAGLRPLVRNPNAASTEGLVRNHMI
HVSDSGLLTIAGGKWTTYRAMAEETVDKAVEVFGLKPKSGCVTEQVRLIGSDGWSRNMFI
GLVQRYGLETEIAKHLSDNYGDRAWTVLSYAQPTGQAWPLHGIRLSPGYPFIEAEVRYAV
RHEYAETAIDVIARRCRLSFLNAQAALDALPRVVEIMAEELHWPAARTKAETAAATEFLL
SMGLMPGATPRPTSTEPKSVVECMETALGVKTGREKRLRRAAQEMVYSRAQFEAGELEAL
KSAFEARAKASATTQAQDVGEPKLKTGELYELVKGLPGFDAVRPKDYEYVMEEVGYARSK
DVDWSEFMEICAELREVLFAPAPSQDKLERRRIPVEKSGGGV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcaagctcgtgaaccgtcgcactatcgctgcagtttctggtgctactgccgtc
gtcgcagctggtggatactactacctcaactcagggcccacttaccccccttctaccaag
gagtctcgccgtccgcccccgctatggacgcccccctctcgcgagcaaatgctcgatgcg
cttagggcctccgctagggacccccatcaggagttcgacctcctcgtcgtggggggtggg
gcgacaggggctggtgttgcgttggatgccgctagcagagggctcaaggttgcgctcgtt
gagcgcgatgacttcagcgcaggaacatcctccaagtcgacgaagctcgttcatggaggc
gtacgctacctccagaaggccgtaatggagctagactacgagcaatacaagcttgtcgtc
gaagctctgcatgaacgacgcatattcctccagacggctccctatctctcgcacatgtta
ccgatcatgttgcctatttataaatattggcaagtcccatattactgggttggatgcaaa
atgtacgatctcttggccggaaaagagaatatggagtcgtcatatctcatgagcaagggc
aaggctcttgaggccttcccgatgctcaagcaagacggcctggtcggtgcattggtttac
tacgatggacaacataacgactcccgtatgaacatagccctcattatgaccgctgtgcag
cacggcgcgatcgtcgcgaatcatgtcgaggtaacctcccttgacaaatcatccgcttcg
ggcaagctgcagggcgcacgcgttcgcgacacgctcaccggcaacgagtgggacgtcaag
gctaagggcgtcatcaacgcgactggtcctttctccgacgcccttctcaccatggacgac
cccaaccacaagccgatcgttcagccctcctccggcacgcacatcaccctgcctaactac
tactctccccggacgatgggtcttctcgaccccgcgacatccgacgggcgcgtcatcttc
ttcctcccgtggcagggcaacaccattgcgggcacgaccgacacaccttcggaggtcgcc
gagcacccgcgcgcccaggaagacgagattcggtggatcctagaggaggtccgccgctac
ctgagcccggatatcaaggtccgtcgtggggacgtgctcagtgcgtgggcgggcctgcgc
ccgctcgtgcgcaaccccaacgcagcgagcaccgagggcctcgtgcgcaaccacatgatc
cacgtgagcgacagcgggctgctgaccatcgcaggtggcaagtggaccacgtaccgcgcg
atggcggaagagacggtcgacaaggccgttgaagtgttcggcctgaagcccaagagtggg
tgtgtcacggagcaagtgcgccttatcgggagcgacggctggagcagaaacatgtttatt
ggtctcgtccagcggtacggcctcgagaccgagattgcgaagcacctctcggacaactac
ggcgaccgcgcctggacggtgctctcgtacgcccagccgacgggccaggcgtggcccctc
catggcatccgcctctcccccggctaccccttcattgaggccgaggtccgctacgccgtg
cgccacgagtacgccgagacggcgatcgacgtcatcgcgcgccgctgccgtctctcgttc
ctcaatgcccaggccgcgctcgacgcgctcccccgtgtcgtcgaaattatggccgaggag
ctccactggcccgctgcacgcaccaaggccgagaccgcggccgcgaccgagttcctgctc
agcatgggcctcatgccgggcgcgaccccgcgcccgacgtcgaccgagccgaagagcgtg
gtcgagtgtatggagaccgcgctcggagtcaagacgggcagggagaagcggctgcggcgc
gcggcgcaggagatggtgtacagccgggcgcagttcgaggcgggcgagctcgaggcgctc
aagagcgcgttcgaggcgcgcgcgaaggcaagcgcgacgacccaggcgcaggacgtcggc
gagccgaagttgaagacgggcgagctgtacgagctcgtgaagggcttgccgggatttgat
gccgtgcggccgaaggattatgagtatgtgatggaggaggttgggtacgcgcgcagcaag
gacgtcgattggagcgagttcatggagatctgcgccgagctacgggaggtattattcgcg
cctgccccgtctcaggacaaactcgagaggcggaggataccggtcgagaagagtggcgga
ggtgtttga

DBGET integrated database retrieval system