KEGG   Dichomitus squalens: DICSQDRAFT_179924Help
Entry
DICSQDRAFT_179924 CDS       T03133                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dsq  Dichomitus squalens
Pathway
dsq00020  Citrate cycle (TCA cycle)
dsq00190  Oxidative phosphorylation
dsq01100  Metabolic pathways
dsq01110  Biosynthesis of secondary metabolites
dsq01130  Biosynthesis of antibiotics
dsq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DICSQDRAFT_179924
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DICSQDRAFT_179924
Enzymes [BR:dsq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DICSQDRAFT_179924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 Lycopene_cycl HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 18840808
NCBI-ProteinID: XP_007364698
JGI: 179924
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MLRKSLNKGLRASSARSFHSSAPARRVVATNPVKAQEVQSFGKYPLIEHEYDAIVVGAGG
AGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPHTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMENGECVGVIALNMEDGTLHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSHL
PPEILHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGKDK
VVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKEIPAEAGL
QSVKFLDQIRKSDGPLPTAKIRLDMQKAMQADAAVFRTQETLDEGVQKLRKIYKSFDQVG
IKDRSMIWNSDLVETLELRNILQCAVQTITAAAARKESRGAHAREDFPERDDEKWMKHTL
TWQRDVSSPEVDIKYRGVIHNTLDENECKSVPPFKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaaatccctcaacaagggccttcgcgcgtcgtccgcgaggtccttccactcg
tctgcccccgcgcgcagagtcgtcgcgacgaacccggtcaaggcacaggaggtccagtct
tttgggaagtaccctctgatcgaacacgagtacgatgccatcgtcgtgggagctggcggt
gccggtctgcgggcagcattcggtttggcggaggccggcttcaacacggcgtgtatcacc
aaactcttccccacccgtagtcacactgtcgcggctcagggtggtatcaacgctgcgctc
ggaaacatgaccgaggacgactggcgatggcacatgtacgatacggtcaagggctccgac
tggcttggtgaccaagatgctatccactacatgtgtcgcgaggctcctcacactgtcatt
gagctcgagcacttcggtgtccccttctcaagaacgaaagagggcaagatctaccaacgt
gcctttggtggtcagtccctcaaattcggcaagggtggccaggcctaccgttgcgctgca
gcggccgaccgtaccggccacgctctccttcacaccctctatggccagtcccttcgtcac
aacaccaatttcttcatcgagtacttcgcgctcgacctgatcatggagaacggcgagtgc
gtcggtgtcatagcgctcaacatggaggacggcactcttcaccgcttccgtgcgcacaag
accgtgctcgccaccggtggctacggccgcgcgtacttctcgtgcacgagtgcgcacacc
tgctcgggtgatggtaacgccatggtcgcccgcgccggtctccctctgcaggaccttgag
ttcgtgcagttccaccctaccggtatctacggtgccggctgtcttatcacagagggttct
cgtggcgagggtggataccttctcaactcggagggtgagcggttcatggagcgttacgcg
ccgacggcaaaggatctcgcgtcccgcgacgtcgtttcgcgttccatgaccatcgagatc
cgcgagggtcgtggtgttggtcccgagaaagaccacatctacctccagctcagccatctc
cctccggagatcctccacgagcgtctccccggtatctctgagacggcagcgatcttctcg
ggagtcgacgtcacgaaggagccgatccccgtcctgcccaccgtgcactacaacatgggc
ggtatccccacgcgctatactggcgaggtcatcaccgttgacgagaacggcaaggacaag
gtcgtccctggcctgtacgccgcgggtgaggccgcttgcgtgtccgttcacggtgcgaac
cgtctcggcgcgaattcgcttctcgacatcgtcgtctttggccgcgcgtgcgcgcaccac
atcaaggagacgctgactcccggcaagccccacaaggagatcccagctgaggctggcctc
cagagcgtcaagttcctcgaccagattcgcaagtcggacggccctctgcccactgcgaag
atccggctggacatgcagaaggccatgcaggccgatgcggctgttttccgtactcaagag
accctcgatgagggtgtccagaagctccgcaagatctacaagagcttcgaccaggtcggc
atcaaggacaggagtatgatttggaactctgacctcgttgagaccctcgagctgcgcaac
atcctccagtgcgccgttcagacgatcaccgccgccgctgcccgcaaggagtcgcgtggt
gcgcatgcccgtgaggacttccccgagcgtgacgacgagaagtggatgaagcacaccctc
acgtggcagcgcgacgtcagctcgcccgaggtcgacatcaagtaccgtggcgtgatccac
aacacgctcgacgagaacgagtgcaagtcggtcccgcccttcaagcgtgtctactaa

DBGET integrated database retrieval system