KEGG   Dichomitus squalens: DICSQDRAFT_183150Help
Entry
DICSQDRAFT_183150 CDS       T03133                                 

Definition
(RefSeq) glutathione-S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dsq  Dichomitus squalens
Pathway
dsq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DICSQDRAFT_183150
Enzymes [BR:dsq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DICSQDRAFT_183150
Transporters [BR:dsq02000]
 Other Transporters
  Pores ion channels [TC:1]
   DICSQDRAFT_183150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 18841290
NCBI-ProteinID: XP_007369734
JGI: 183150
UniProt: R7SNL8
LinkDB All DBs
Position
Unknown
AA seq 255 aa AA seqDB search
MGLPDEQIHPIATGRAVQTVEQHQESQDLVFYSGWFCPYVQRVWITLEERGIPYQYKEVN
PYKKEPHFLAINPKGLVPAIEYTGRALYESLIICEFLEDAFPDHEPHILPSDPFDRALVR
LWTDHVSKQIVPGFMRLVQAQDSQKQREYLEEFNKALRTISAQVKGPYFLGEQFTLVDVA
LAPWVVRDYIVAEHRGYSREAVGNGWKEYAVQLETRESVLRTQSDRVYYTEIYGRYLRDE
AQSEAAKAIRAGRSF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtctaccagatgagcaaatccaccctattgcaactgggcgcgctgtgcaaaccgtc
gagcagcatcaggagtcgcaggatttagttttctactcgggatggttctgcccatatgta
caacgagtgtggatcaccctcgaggagcgtggtatcccttaccagtacaaggaggttaac
ccgtacaagaaggagccacatttccttgcaatcaacccgaagggtctcgttccggcgata
gagtatacgggtcgcgctctatacgaatcactcatcatctgcgagtttcttgaagacgct
ttccccgaccacgaaccccacattctcccgtccgatccattcgatcgagccctggttcgc
ctctggaccgatcatgtcagcaagcaaattgtccccgggttcatgcgattggtccaggca
caagattcacagaagcagcgcgagtatctcgaggagttcaacaaggcgctccgcactatc
agtgcgcaggtgaagggtccatactttctcggagagcagtttacgctggtcgatgtcgcc
ctcgccccgtgggttgtcagagactacatcgtcgcagagcaccggggatacagtcgtgag
gctgttggcaatggctggaaggaatatgccgtacaactggagacgcgcgagagtgtgctg
aggacgcaaagcgatcgtgtttactacaccgagatctatggtagatatctccgcgacgaa
gcccagagcgaggcggcgaaggcaattcgagctggacgttcgttctga

DBGET integrated database retrieval system