KEGG   Dichomitus squalens: DICSQDRAFT_51288Help
Entry
DICSQDRAFT_51288  CDS       T03133                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dsq  Dichomitus squalens
Pathway
dsq03030  DNA replication
dsq03410  Base excision repair
dsq03420  Nucleotide excision repair
dsq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dsq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DICSQDRAFT_51288
   03410 Base excision repair
    DICSQDRAFT_51288
   03420 Nucleotide excision repair
    DICSQDRAFT_51288
   03430 Mismatch repair
    DICSQDRAFT_51288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dsq03032]
    DICSQDRAFT_51288
   03400 DNA repair and recombination proteins [BR:dsq03400]
    DICSQDRAFT_51288
Enzymes [BR:dsq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DICSQDRAFT_51288
    6.5.1.6  DNA ligase (ATP or NAD+)
     DICSQDRAFT_51288
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     DICSQDRAFT_51288
DNA replication proteins [BR:dsq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    DICSQDRAFT_51288
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     DICSQDRAFT_51288
DNA repair and recombination proteins [BR:dsq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DICSQDRAFT_51288
   NER (nucleotide excision repair)
    Other NER factors
     DICSQDRAFT_51288
   MMR (mismatch excision repair)
    Other MMR factors
     DICSQDRAFT_51288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 18842321
NCBI-ProteinID: XP_007361938
JGI: 51288
LinkDB All DBs
Position
Unknown
AA seq 752 aa AA seqDB search
MPQRTIGNATPSENPIYEPLNVDPPLYDPACTPWAPQSPVPYSFLAHALATLSSTRSRIA
KLDTLTNALRTICRQHPPSLLPALYLLSNALSPPYSPTELGLGPTTISKAIQHVSGLSPA
ALKRLYNATGDPGQPRAFSDRDVAFEAKSNVRTLIPHPPLLITGVYSSLLKIAHAKGPGA
AKTKQAIVEKLLVSARGEETRYLVRTLGQNLRVGAVRTSLAALARAMVLTPPVELSAPTP
DDSPFRISAELLEEVKPLLAQKKVADEARDALNDVYLRAESLIKRVYVQHPNYDHIVKAL
LEVGLDGLSAQLPLTVGVPLLPTLGSPTRSLDEIYDRLGFLPFTAEFKYDGQRAQIHASR
GDNDRPFVKLFSRHLEDMTDKYPDVVSLVDGIFLSTPQTESFIIDAEVVAIDPGTGALKT
FQELSNRARKEVKLDEVKVAVCVFAFDLMYLDGQILLERSFRDRRTVLRTRFPPYTPPQK
GAARFDHVKSVESEDGREVVEEFWQAAVNSSSEGLMVKLLDSGEILEEPNQKKDKPRRKP
LPATYEPDKRTSAWLKLKKDYVTGLSDSLDLVPIGAWHGNGRKAQWWSPILLAVWDPDAE
KLVAVCKCMSGFTDAFYKSLRERYPEDSDSCSSRPMWEPECDTGGLRPEVYFKPQEVWEI
RGADITISPVSVAALGLVSQTRGLSLRFPRFISLREDKAVVDASTPEFLANIYRMQQAAG
KDQTGADEGELVDVALDDGGQDDESEESEADS
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgccacagcggacgattgggaacgcgaccccgtcggagaatccaatttacgagcccctg
aatgtcgatcccccattgtatgacccggcatgcactccttgggctccccagagcccagtc
ccgtactcgttcctggcacacgcccttgcgacgctctccagcacacgctcacgaattgca
aagttagacacgctgacaaatgcattgcgcactatctgccgacagcatcccccgtccctt
ctcccggcattatacctactgtcaaatgctctctcgccgccttattcgcccactgaattg
ggactgggccctacgaccatctcaaaggctatccagcacgtttccggacttagtcctgct
gcgctgaaacgcctgtataatgcgactggcgatccaggtcagcctcgggctttttccgat
cgggacgtagcatttgaggctaaatcgaacgttagaactctcattccccatccgcccctt
ctcatcaccggcgtctactcttctctgttgaagattgcccatgcgaagggtccaggcgcc
gctaagaccaagcaggcaatcgtagagaagcttctggtctctgcccgaggggaggagacg
cgctacctcgtccgcaccctaggacaaaacctccgcgtaggtgctgtcagaacttccctt
gcggcacttgcgagggcgatggtcctcacaccacccgtggagctatccgcaccaacgccg
gacgattcccctttccgcattagtgcagaattgctcgaggaggttaagcccttgttggct
cagaagaaagttgccgacgaagcccgcgatgcgctgaacgacgtgtacctccgcgcagaa
agtctgatcaagcgggtctatgttcagcatcctaactacgatcacatcgtgaaggcgctg
ctagaagtcggccttgacgggctctcagcccagctgcctttgactgtcggggttccatta
cttcccaccttaggttccccgacgcgctctcttgacgaaatctacgaccggttaggattc
ttgcctttcacggccgagtttaagtatgacggccagcgcgcccaaatccatgcttcgagg
ggtgataatgataggccgttcgtcaagctgttctcgcgacatctcgaagacatgaccgac
aagtatccagacgtggtctcattagttgacggaatcttcctatctacgccgcagacagag
tctttcatcatagacgcagaggtcgtggcaatcgaccctgggaccggcgcgctcaaaaca
ttccaggaattatcaaaccgcgctcgtaaggaagtaaaacttgacgaagtgaaggtcgcc
gtctgcgtctttgcgttcgatctcatgtatctcgacggtcagatcctgctcgagcgatcg
ttccgcgaccgccggactgtgcttcgaacgcgatttccgccttacacgccgccgcagaag
ggcgcggcacgtttcgatcacgtcaaaagtgtcgaaagcgaagatgggcgggaggtcgtc
gaggaattttggcaggccgccgtcaacagctccagcgagggcctcatggtcaagcttctc
gatagcggcgagatcttggaagaacctaaccaaaagaaagacaaaccgcgtcgcaagccc
ttacctgccacatatgagccagacaaacggacctccgcgtggttgaagctaaagaaggac
tatgtgacaggattgagcgacagtctcgatctcgttcctattggcgcgtggcatggcaac
ggtaggaaggcacaatggtggagtcctatcctactcgccgtatgggatcccgacgcggag
aagctcgtcgcggtgtgcaaatgcatgtcaggctttaccgatgcattttataagagcttg
cgtgaaagataccccgaagattctgacagctgttcgtcgcggcccatgtgggagcccgag
tgtgatacaggtggacttagaccggaggtctacttcaagccgcaagaagtgtgggaaatt
cggggcgccgatatcacaatcagtcctgtctccgtcgcagcattagggctcgtgtcgcag
acaagaggactgagtctgcggttcccgcgcttcatatcgctccgcgaagacaaggccgta
gtagacgccagcacgccggaatttctcgcgaatatataccgcatgcagcaagccgctggg
aaggatcagactggtgcggatgagggggagcttgtagatgtagcattggatgacgggggc
caagacgacgagagtgaagagtcggaggcagattcgtag

DBGET integrated database retrieval system