KEGG   Dichomitus squalens: DICSQDRAFT_59500Help
Entry
DICSQDRAFT_59500  CDS       T03133                                 

Definition
(RefSeq) GroES-like protein
Organism
dsq  Dichomitus squalens
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 18842894
NCBI-ProteinID: XP_007365400
JGI: 59500
UniProt: R7SZV5
LinkDB All DBs
Position
Unknown
AA seq 398 aa AA seqDB search
MRAIRYYGPGDVRLDEIPEPRVGDRQVKIKAFTFCLNGICGSDLHAWDALLPVTPTHTEP
HVVTGETLPIVMGHEMSGTIVEVGSQVNTSRLKAGVNVVVEPILACRKAACSPCQEGTRN
VCPHITFIGLGGGGGGLSEYIAVDEDLVQVLPDGVPLEFGALMEPLAVSWHAVKRSGIKA
GDKVLILGGGPVSRTFVVVLKLFGASWIALSEPALKRRELATSQGADVVYDPTSPGLDVV
EAVREATGTRRGADIVFDCAGTQRTLDAAFQAVRPRGSVVNVAIWDHKPLLDIGAITLKE
ITFTGVISFDRVHNDMLKAVAEGKFNGIENIITRRIGLEDFVEKGIKALVNEKDEQGESY
NVSSGKGSPTVLIGILDETLQSRYWFILVPGDLHRPGI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagggccatacgttactacggacctggagacgtacgccttgacgagatacccgagcct
cgggtcggggatcgtcaggtgaagataaaggcattcactttctgcttgaacggcatctgc
gggtccgatctgcacgcttgggatgccctccttcctgtcaccccaacccacacagaaccc
catgtcgtcacgggcgagacactgcccatagtcatgggtcatgagatgtccggtacgatc
gtcgaggtcggctcccaggtgaacacatcccggttgaaggctggggtgaatgtggtcgta
gagccaatcctagcatgcaggaaagcagcgtgttcaccttgccaggagggtacgcggaac
gtttgccctcatattacattcattggcttgggcggtggcggtggcggtctctcggaatac
atcgccgttgacgaggatctcgtccaggttctgccggatggagtacccttggaatttgga
gccttgatggagcctttggctgtttcctggcatgcggtcaagagatcgggtattaaagcc
ggagacaaggtgctcattcttggtggcggtccagtgagtcggacttttgttgtcgttttg
aagctatttggtgcgtcgtggatcgcactatccgagcccgccttgaaaaggcgcgagctg
gcgacgtcccaaggcgccgatgttgtttacgaccccacctctcccggtctcgacgtagtg
gaggccgtgcgcgaagcgacaggaacccgccggggcgctgacatcgtttttgactgcgct
ggcacccaacgcacattggacgccgcgttccaggccgttcgtccgcgaggaagtgtggtg
aacgtggccatatgggaccataaacccctgctcgatataggtgcaatcaccctcaaggag
atcactttcacgggcgttatttcgttcgatcgcgttcataacgacatgttgaaggctgta
gcggagggaaagttcaacgggattgagaatatcatcacgcgacggatcggtttggaagac
ttcgtcgagaagggtatcaaggcgttggtgaacgagaaggatgagcaaggtgagtcctac
aacgtctcttctgggaagggttcgcctaccgtactcatcgggatcctcgacgaaacacta
cagtcaagatattggtttatcctggtgccgggggatctgcatagacctggaatctaa

DBGET integrated database retrieval system