KEGG   Dichomitus squalens: DICSQDRAFT_97125Help
Entry
DICSQDRAFT_97125  CDS       T03133                                 

Definition
(RefSeq) cAMP dependent protein kinase
Organism
dsq  Dichomitus squalens
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 18845280
NCBI-ProteinID: XP_007360982
JGI: 97125
LinkDB All DBs
Position
Unknown
AA seq 463 aa AA seqDB search
MEYPLYPAFRSASLPNHTSLTLSTTPDLSAFRRDSDYMLSDGPITPPLSPGRSDEGEAII
VDSEPRYSGPDGQLQPSLPHPHLRDIETARRGRRSHQQEGMDVDTRALASSPRPPQRHLE
DEPSHLEKGTLKLTDFEVKGTLGTGTFARVLLVRLRASSGQSSTSNCFALKVLRKTEVVR
LRQVEHVNGERYILSRVRHPFIVDLYATFQDSLNVYMLMSYVPGGELFTHLRRAKRFTAD
VTRFYLATIVLALKYLHSFNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGT
PEYLAPEIIQSDGHGKAADWWACGILCYEMIVGYPPFFDETAYGIYEKILKGKIHWPREV
DPLSKDIIKGFLHPDRSKRLGNLIGGSQDVLDHPWFRGVDWDALERREIRAPIVPHVASV
DDTRNFSHLPLPPPDEIPGLIREERPPSIQQRFDSVAYQFLEF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaataccccctctatcccgcctttcgctctgcctccctgccgaaccatacctcactc
accctttccacgacgcctgacctcagcgcattccgtcgcgactcggactacatgctcagc
gacggaccgatcactccgcctctatcccccggacgaagtgacgagggagaggccatcatc
gtagactcggagccgcggtattccgggcccgatggccagctacagccttcgttaccccac
ccgcaccttcgcgacatagagacggcccggcgtgggcgccggagtcaccagcaggaggga
atggacgtcgacacgcgggcattagctagctctccacgtccgccacagcgccacctagag
gacgagccatcgcatttagagaagggcacgctgaagttgacggacttcgaagtcaagggc
acgcttggcactgggacatttgcgcgtgttcttcttgtgcggcttcgagcctcttctggc
cagagcagcacatcaaattgctttgccttgaaggtgcttcgcaagaccgaggtcgttcgc
ctccgacaggtggagcatgtgaatggcgaacggtacatcttgtcacgcgtacgccacccc
ttcattgtcgacctctatgctaccttccaggacagcctcaacgtctatatgctgatgtcc
tacgtcccggggggagagcttttcacgcacttgcgtcgtgccaaacgcttcaccgcggac
gtcacccgtttctatctcgccacgatcgtactcgctctcaagtaccttcactccttcaac
atcatctaccgtgacctgaagcctgagaatctacttttggactcccgcggctacctccgc
ctgaccgactttggtttcgcgaaaattgtagacgaccgtacgtggacgttatgcgggacg
ccggaatatctcgccccagaaattattcagtcggatggtcacggtaaggcagccgattgg
tgggcctgcggtatcctctgctatgagatgatcgtcggctacccacccttcttcgacgag
accgcgtacgggatatatgaaaaaatcctcaagggcaaaattcactggccgagggaggtc
gacccgctatccaaagacattatcaagggtttcttgcatccggacagaagcaagcggctc
ggcaatctcatcggaggctcgcaggacgtcttggaccacccctggttccgcggcgtagac
tgggatgcgcttgagcgtcgtgaaatcagagcacctatcgtcccccacgtcgcctcagtt
gacgatacgcgtaacttctcgcacctccctcttccccctcctgacgagatacctggtctc
atccgtgaagaacgcccgccctcgattcagcagcggttcgactccgtcgcgtaccagttc
ctcgagttctga

DBGET integrated database retrieval system