KEGG   Drosophila serrata: 110178850
Entry
110178850         CDS       T06108                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
dsr  Drosophila serrata
Pathway
dsr04013  MAPK signaling pathway - fly
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
dsr04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110178850
   04391 Hippo signaling pathway - fly
    110178850
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110178850
   04215 Apoptosis - multiple species
    110178850
SSDB
Motif
Pfam: TNFR_c6 Comm PhoR
Other DBs
NCBI-GeneID: 110178850
NCBI-ProteinID: XP_020801769
LinkDB
Position
Unknown
AA seq 359 aa
MLPPRLLQPGSGPAELDLELDKDEEEMHTMFHKRRRRRSSWLKGGPACLTLLVMLLLYAV
ASCTAASPASTEVSAPDDPPLAPALATAISSSSSSPCAPQHWWDSQRDRCTACTRCQGEM
IPLRPCQLHTDTICGSIYDLKIDWVVLAKTEPNWKERRKSSEYEHFGQNAAPLQHLSHEQ
LQQLHEEATAAAAWALDWQTGVLYVAVLTCLIFFSVAACILIHHMRQWRRMERRLDQDVE
ELSTKLMAKLAEVQSLDGGTFFIGNADALRGLPSSAMVTATSASVAASHAAAAAAAAAAA
SHSQGIFQPQHVLLPEKRNGGKHQERRILKALQPGNVYIEESNVPPGGFGHGLGMGHKN
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgttgccgccaagactgctgcagccgggcagcggcccagcggaattggatttggagttg
gacaaggatgaggaggagatgcacacaatgtttcacaagcgaaggcgcagaaggagcagc
tggctaaagggtggtcctgcctgcctaaccctgctcgtaatgctcttactatatgcagta
gcatcctgtacagccgcctcacccgcctccacagaagtgtctgcaccggatgatcctcct
cttgcaccagctcttgcaacggccattagctcctcctccagttcaccctgtgccccccag
cattggtgggactcgcaacgtgaccggtgtacggcctgtacccggtgccagggtgaaatg
ataccgctgcgtccatgtcaactgcatacggataccatttgtggttctatctatgacctc
aagatcgattgggttgtcctggccaagacagagcccaactggaaggagcgtcgaaagtcc
tcggagtatgagcattttgggcaaaatgctgcccccttgcaacacttgagtcacgagcaa
ctgcagcagctgcatgaggaggccacggctgccgctgcctgggcattggattggcagacc
ggtgtcctctatgtggcagtgcttacctgcctcatatttttctctgtggccgcctgcata
ctcattcatcacatgcggcagtggcgccgcatggagcgacgcctggatcaggacgtggag
gagctgtccacgaagctaatggccaaattggccgaggtccagagtctggatggcggcacg
ttcttcattggcaatgcggatgccttgcggggattacccagttcggccatggtgacggcc
acatcggcgtctgttgccgcctcccatgccgcggcggcggcggcagcagcggcagcggca
tcccactcccagggtatctttcagccgcaacacgtgctgttgccggagaaacgcaacggt
ggcaagcaccaggagcgtcggatcctgaaggctcttcagccgggcaatgtgtacatcgag
gagagtaatgtgccacctggtggctttgggcatggcctgggcatgggtcacaagaactag

DBGET integrated database retrieval system