KEGG   Drosophila serrata: 110178947
Entry
110178947         CDS       T06108                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
dsr  Drosophila serrata
Pathway
dsr04013  MAPK signaling pathway - fly
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110178947
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110178947
   04215 Apoptosis - multiple species
    110178947
SSDB
Other DBs
NCBI-GeneID: 110178947
NCBI-ProteinID: XP_020801905
LinkDB
Position
Unknown
AA seq 437 aa
MAVPFFLPEGGTDDVASSSSGASGNSSPHNHPHSHPHAHNHSHPPLSAHSSSASSSSSSS
GVSSASSSSSSASSSSSASSDGASSVASQSPNTTSSATQTPMQSPVPTDQVLYALCEWVR
IYQSQQSAPQIFQYPPPQSPSCNYTGGDVFFPHGHPNPHPRTPRTSVSFSSGEEYNFYRQ
QQQQQQQHLPYPAPSTPQPMPPQPPQSAPAMHCSHSYPQQSPHLLHPGYGPYYATYTPPP
TPNTASAGTSTSSAAFGWHNHVHSPSLASTPLAPKMRLQRSQSDAARRKRLTSTGEDERE
YQSDHEASWEFEFDDRYDNFTAGRERLQEFNGRIPPRKKKNSHSHSHSHSSSTNNNANNN
SNINNHQTISQNINQASNTSNNTENSSSSSSNCSHSQQQRQVERERQRTQAEKKSFTWPT
VVTVFVLAMGCGFFAAR
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttttctgcccgagggcggcaccgatgacgtagcctccagctcatcg
ggtgcctcgggcaactcctccccacacaaccacccgcacagccacccacacgcccacaac
cacagccatcccccgctttctgcgcactcctcgagcgcatcctcctcgtcgtcgtcgtcg
ggagtgtcctccgcctcctcctcatcatcatccgcttcgtcctcttcatccgcctcgtcg
gacggcgccagcagcgtcgcctcgcagtccccaaacaccacatcctcggccacgcagacg
ccgatgcagtcgccagtgcccactgaccaggtgctctatgccctctgcgagtgggtcagg
atctatcagagccagcagagtgcccctcaaatcttccagtatccgccaccgcagagcccc
tcctgcaattacaccggcggcgatgtattctttccccacggccatccgaatccacatccg
cgcactccccgcaccagcgtgagcttctcctccggcgaggagtacaacttctatagacag
caacagcagcagcagcagcaacatttgccatacccggcgccatcgacaccgcaaccgatg
ccaccacagccgccacagtcagcgccggcgatgcactgcagccacagctatccacagcag
tcgccccacctgctccatcccggctatgggccctactatgccacctatacgccgccgccc
acaccaaacacggccagtgccggcacctcgacctcctcggcggccttcgggtggcacaat
catgtccatagtccatcgctggcgtccacaccactggcgcccaagatgcgtctgcagcgg
agccagtctgatgcggccagacgcaagcgattgacctcgacgggcgaggatgagcgcgaa
tatcagagcgaccatgaggcaagttgggagtttgagtttgatgatcgttacgacaatttt
acggccggacgggagcgtttacaggagttcaatggacgtataccgccccggaagaagaag
aacagccatagtcacagtcacagtcacagcagcagcacaaataataatgccaacaataac
agcaatattaataatcatcaaacgattagccaaaatattaatcaagccagcaacacctcc
aataatacggagaacagcagcagcagcagcagcaattgcagtcacagtcagcagcagcga
caggtggaacgggagcgacaaaggacacaggctgaaaagaagagcttcacctggcccacc
gtggtgactgtcttcgttttggccatgggctgtggcttttttgcggcgcgatga

DBGET integrated database retrieval system