KEGG   Drosophila serrata: 110178962
Entry
110178962         CDS       T06108                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dsr  Drosophila serrata
Pathway
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110178962
   04215 Apoptosis - multiple species
    110178962
SSDB
Motif
Pfam: Bunya_NS-S
Other DBs
NCBI-GeneID: 110178962
NCBI-ProteinID: XP_020801924
LinkDB
Position
Unknown
AA seq 66 aa
MAVAFFIPDQATLLRKAEQDERQILRMRETQWRFLATIVLETLQQFSQYSLPKSGRKSGK
YRKPSQ
NT seq 201 nt   +upstreamnt  +downstreamnt
atggcagtggcattcttcatacccgatcaggcgactttgctccgaaaagcggagcaggat
gagcggcaaatcctgcgaatgcgggaaacccaatggcgtttcctggccaccattgtcctg
gaaacccttcagcagttcagccaatacagcttgcccaagtcgggcagaaaatctggaaaa
tatcgcaaaccatcgcagtga

DBGET integrated database retrieval system