KEGG   Drosophila serrata: 110178968
Entry
110178968         CDS       T06108                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
dsr  Drosophila serrata
Pathway
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110178968
   04215 Apoptosis - multiple species
    110178968
SSDB
Motif
Pfam: Presenilin DUF4175
Other DBs
NCBI-GeneID: 110178968
NCBI-ProteinID: XP_020801932
LinkDB
Position
Unknown
AA seq 143 aa
MAIAYFIPDQAQLLARSYQQNAQQATTTSQRTSSATSTQQPGQQAQPSQEQPAQQHQRQS
QHRPQFRANISVPLGRQQGSMTMSEFGCWDLLAQIFCYALRIYSYNSSQRRPTVIQISFE
ISGGSLDQDSDDDVTDATASKDN
NT seq 432 nt   +upstreamnt  +downstreamnt
atggccattgcatacttcatacccgaccaggcccaattattggcccgaagctatcagcaa
aatgcccaacaggcaacaaccaccagccaaaggacatcatctgcaacatctacacaacag
ccaggacaacaggcgcaaccttcacaggagcaacctgcacagcaacatcaacgacagtcc
caacatcgtcctcaattccgagccaacatatcggtacccctgggcaggcaacaaggatcc
atgaccatgtcagagttcggatgctgggatcttctggctcaaatcttctgctatgctcta
aggatctacagttacaattccagccagcgacgaccgacggtcatacaaatatccttcgaa
atcagcggcggcagtctagatcaggactctgatgacgatgtaaccgatgccaccgcctcc
aaggataactag

DBGET integrated database retrieval system