KEGG   Drosophila serrata: 110180260
Entry
110180260         CDS       T06108                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
dsr  Drosophila serrata
Pathway
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110180260
   04215 Apoptosis - multiple species
    110180260
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110180260
NCBI-ProteinID: XP_020803575
LinkDB
Position
Unknown
AA seq 300 aa
MPGTSYPTNNDNFSHGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGSQRGEAT
RRRLSNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQ
RIRSILGSTSMGIVRDVFPAVQVLGDELERMHPRVYNGVARQICRNPGGEFHTPDAVSLL
LGAVGRDLFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWI
NENGGWGGINTHVLPTSNSLNPLEWTTLVIGVVFGLILVFMILRFIISTIIPKIYQRFTS
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataacgataatttcagccacggtttccccatggcc
accacccaaagtgaacgcttgctgcaggctcagaatcgtaggaaattcagttttccagcc
actttgcattccgcctccttgttggaggtgggtggcggtagtcagaggggagaggccaca
aggaggagactgagcaatgtcagcgatgtggtcaccaggaagctttcctatacgattggc
tggaaggcggcacagattccagcgcaggatatcatcacacagggtcgctgtttgtgtggt
cactatatcaaacgacgcctgagaagatcaggtttgtttaataaaaagttgggattgcag
cggatacgcagcatcctaggttccacctccatgggcattgtacgtgatgtctttccagct
gttcaagtgctgggcgacgaactggagcgaatgcatccgcgtgtctataatggcgttgcc
cgtcagatttgccgcaatcctggcggtgaattccacactccagatgccgtgagcttgctc
ctcggagccgtgggacgtgacctctttcgcgtggagatcacctggagcaaggtaatctca
ttgtttgccattgccggtggcctgtccgtcgactgtgtgcgtcagggtcatccggaatac
ctgcccaagctgatggagagcgtgtctgaggtcattgaagatgagctggtgccttggatc
aatgagaatggtggttggggcggcatcaatacccatgtcttgcccactagcaacagtttg
aatcccttggagtggaccactctggtgattggtgtggtctttggattgattttagttttt
atgattctccgatttataatcagcacgataataccgaaaatataccaacgatttacaagt
tga

DBGET integrated database retrieval system