KEGG   Drosophila serrata: 110181126
Entry
110181126         CDS       T06108                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dsr  Drosophila serrata
Pathway
dsr04214  Apoptosis - fly
dsr04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110181126
   04215 Apoptosis - multiple species
    110181126
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dsr01002]
    110181126
Enzymes [BR:dsr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     110181126
Peptidases and inhibitors [BR:dsr01002]
 Cysteine peptidases
  Family C14: caspase family
   110181126
SSDB
Motif
Pfam: Peptidase_C14 DUF4347 Patatin
Other DBs
NCBI-GeneID: 110181126
NCBI-ProteinID: XP_020804457
LinkDB
Position
Unknown
AA seq 318 aa
MTDECITRNYNVLSIIADSIDAKGCTAEPLVVAGVGGGAIAASAAAVLPANKFVARMPVE
RYASEYNMNHKNRGLALIFNHEFFDIPTLKSRTGTNVDAQELSKTFENLGFKVAVHKDCK
LRDILKQIEKAAVQDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTAAFCPTLA
GKPKLFFIQACQGDRLDGGMMLEKSVTETDGESSMSYKIPIHADFLFSYSTIPGYYSWRN
INNGSWYMQSLIQELNTNGKKYDLLTLLTFVNQRVAIDFESNVPATPIMDRQKQIPCLTS
MLTRILRFSDKPNGNKAG
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggacgagtgtataacaagaaactacaatgttctcagcattatagctgatagtatc
gatgccaagggctgtacggcggagccgcttgttgttgctggtgttggtggtggtgcaatt
gcagctagcgccgccgccgtcttgccggccaacaagtttgtggcccgaatgcccgtggag
cgatatgccagcgaatacaacatgaatcacaagaaccgtggcctggctctgatcttcaac
catgaattctttgacatacccacgttgaagtctcgcaccggcactaatgtggatgcccaa
gagcttagcaagaccttcgagaatctgggctttaaggtcgccgtgcacaaggactgcaag
ctgcgggacattctcaagcagatcgaaaaggccgccgtgcaggatcacacggataacgac
tgcctggctgtggccatactgtcgcacggcgaacacggatatctgtacgccaaggataca
cagtacaagctggataatatctggcactacttcaccgccgccttctgtcccactctggcg
ggcaagccgaagctgttctttatccaggcctgccagggcgaccgcttggatggcggcatg
atgctggagaagagcgtgactgaaacggatggcgagtcctccatgagctacaaaataccc
atacacgctgactttctcttctcctattccacgattccgggttactactcgtggcgcaac
atcaacaacggctcctggtatatgcagtcgctgatccaagagctaaacaccaatggcaaa
aagtacgacttgctcactttgctcaccttcgtcaaccagcgtgtggccatagactttgag
tcgaacgtgcccgccaccccgataatggatcgccagaagcaaataccatgtctcacctcc
atgctgacgcgcatactgcgcttcagcgacaagcccaacggcaataaggctggctaa

DBGET integrated database retrieval system