KEGG   Drosophila serrata: 110185021
Entry
110185021         CDS       T06108                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dsr  Drosophila serrata
Pathway
dsr00230  Purine metabolism
dsr01100  Metabolic pathways
dsr04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110185021
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110185021
Enzymes [BR:dsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110185021
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 110185021
NCBI-ProteinID: XP_020809332
LinkDB
Position
Unknown
AA seq 1170 aa
MSEEKDGNVDNGQAMAKSKQQRQKTPPARRRQNDSDVVAGGVGITGGGVVILPQHVLNEL
YHNYSIKQRRSGLKWFLFAAVLFNIWTIAIPWDQAVPTRVVNCCMLVAYLALTALLHIGR
RSEKPALKRFHQILLTIVPRALWLLSVLHFSAYVILQPSFSPRDILGWAILLNFLVYVTL
PLPLIFLGLSIGCSTYFISLTLPVGYSRSDPLLSNQLAANAVLIATAALIGLLYYFMGEA
KQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMS
RHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCI
SGAPDERPDHAVMCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFD
VYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTYFIT
KVVKPFASPCAKKINEIRTENSRNGSINDLVNEEDDDNDASLDDEELLAQKVIANGQQTT
VAEDEEEQVKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQCYAVYREPYSSL
PLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVVISIAESFSGMLPKFFVDV
SKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFNATGGLEGEVDD
DDGVVTAEHLLPESFVEQMREAVPTERILYPSYLSNFGILILIAIAVIAQLTHLTKILLL
LSIAALHCYFNIFIMQDFYAVEDDLAHQPIISTRFCASGLLVVAALALSTLARHMDHEDR
VIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGV
LFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMGA
SGINLQRNLRSDAPITERWSHLAVLVEFALELKHALQGINEQSFNHFVLKMGINHGPITA
GVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCNILQQFGYTFLQRGLVAVKGK
GQLMTYYLQGKSQPNAEPEGAPPSIELHGPEALALDSSTVELESSDIKTPLLKIKAQEQS
AETEGIVVQESETLGNGNAGPMGGESQSLL
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgtcagaggagaaggatggcaatgtggacaacggtcaggcgatggccaaatcaaaacag
caacgccaaaagactccaccagcccggcggcgacaaaacgacagcgatgtggttgccggc
ggtgttggaataaccggcggtggagttgtcatccttccacaacatgtgctcaatgaactc
taccacaattactcgattaagcagcgacgaagcggtctcaagtggttcctctttgctgcc
gttctatttaacatctggactatcgcaataccctgggatcaggcggtgcccacaagagtg
gtcaactgctgcatgcttgttgcatatttagctttaacagctcttctacacattggacga
cgatctgagaaaccggcattgaagcgcttccatcagatactcctaacgattgtgccgcga
gcactgtggctacttagtgttcttcacttttctgcctatgtgattcttcagccaagcttt
tctccaagggacattcttggatgggccatcctgttaaacttcctagtatatgtcacgctg
ccattgcctctgatttttctgggcctgtcaattggatgctcgacgtattttatttctctt
actctgccagtgggctactcccgttcggatcccttgctctcgaatcagttggccgccaat
gcggtgttaattgccactgcagctttgattgggctcctgtactactttatgggggaggcg
aagcagaagcgagctttcctcgaagctaaaaagagtcttgaggttaaaatggtaatcgag
gaacaatcagccgaacaggagcgattgctgttatccgtgctgcctaagcacgttgccatt
aaaatgagggaggatttgggatcctccagttcggaggcatttaagaagatctatatgagt
cgtcacgagaatgtgagcattctatatgcggatattgtgggctttaccgccatctcctcc
acctacagcgctcaagatttggttaaaatgcttaacgagcttttcgcacgcttcgatagg
ctcgccgagaaatatcaacaattgcgtattaagattcttggcgattgctattattgcatt
agcggtgcccccgacgagcgaccggatcacgccgtgatgtgcgtgcacatgggactatct
atggtgaaggccatcaaatatgtgcagcagaaggccaactcacctgttgatatgcgggtg
ggcatacacacgggagcagtgttagccggcattctcggccagcggcagtggcaatttgac
gtttactccaaggacgttgagttggctaataaaatggaatcgagcggcaaggctggacgc
gttcacatttcggacaaaacgttggccttcctcaacggagaattcgaggtggagccagcc
tttggggagaagcgagaggagctgttgcgcatagctggtctaaagacatattttatcaca
aaggtggttaagccgttcgcttcaccatgtgccaaaaaaatcaacgaaatccgaacagaa
aactctcgtaatggttctatcaacgatttggtaaacgaagaagatgatgacaacgatgcc
tccttggatgatgaggagcttctagctcaaaaagtcatagccaacggccaacaaacaact
gtggcagaagatgaggaggagcaagtgaaactggaaaactttaagcaacgattgaaagac
gaactggtaacacgtgatggacatgagaaccttacaaaagacacaaacattttcctgcgc
ttcaaaaacccgcaattggagcagtgttatgctgtctacagggaaccctacagttcactt
cccctcctggctgctcttctagtacagtgcatagatgtattgtactcatacttggtgctt
cctcgatccaccctacacttcatcaacatcgcggcaccattggttccgatcgccatgcta
gtggtgatcagtatcgccgaaagttttagcggcatgttgcccaagttctttgtggatgtg
agcaagcggttcaatgacatcacattcgtccgcgagttggctgccattattatagcactc
actattggactcagcaatgtcatcgacatgttctttttcgtaacttttgttcgcacggag
catatagtcagtgagagcgaattcaatgctacgggaggcttggagggcgaggtggacgat
gacgacggagtggtcaccgcagagcacctgctgcccgaatcgtttgtggagcaaatgcgc
gaggcagtgcccacggaacgcatcctgtatccgtcctacctgagtaattttggaatactt
atattgattgcgatcgctgtaattgcacaacttacacatcttacaaagatacttctgttg
ttgtccattgccgctctgcattgctactttaatatattcattatgcaagacttttatgct
gtggaggatgatttggcacatcaacctataatatctacacgattttgcgcctcaggactt
ttggtggtagctgccttagcgttaagcactttggccagacatatggatcacgaggatcgg
gtaattttcaaatggaaaaccgaggtggccgagcaaaaagagaccgccaatgacatgcgg
cagaggaatgaggctttggtctacaatgtgttgcccgttcatgttgcggagcatttcatg
aagaacacaaaacgctcccacgatgatttatactcgcagagttatgccgaggttggagtt
ttgttcgccagtatgccaaatttttcggatttctattcggaagagaccgttaataatcag
gggctggagtgtctacgttttctcaacgaggttatttccgattttgatgcgttgctggag
ctgccacagttccaagatatcatcaaaatcaagacgatcggttccacttacatgggcgcc
agcggcattaatctgcagcgcaatctgcgaagcgacgctcccatcaccgagcgctggtcc
cacctggctgttttggtggagttcgcattagaactgaagcacgccctgcagggcatcaac
gaacagtccttcaatcatttcgtcctcaagatgggcattaaccatggcccgataacggcg
ggcgttattggtgcccgtaagcctcactatgacatctggggcaatacggtaaacgtagca
tcccgcatggagagcactggaaaagcgggcgccattcaagtcactgaggagacatgcaac
attctgcagcagtttggatacacatttttgcaacgtggtttggtggctgtcaaaggaaag
ggtcaactgatgacctactatttgcagggcaaatcccagccgaatgcagagccagaggga
gcaccaccctccattgagttgcatggacctgaggcattggctctagactcctccaccgtc
gagctggagtcctcagatatcaagacgcccctactaaagattaaagcccaggagcagtca
gcggagactgaggggattgttgttcaagagtcagagaccttgggaaatggaaacgctggc
ccaatgggtggggaatcgcagtccttgctttaa

DBGET integrated database retrieval system