KEGG   Azospira oryzae: Dsui_0052Help
Entry
Dsui_0052         CDS       T01657                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
dsu  Azospira oryzae
Pathway
dsu00010  Glycolysis / Gluconeogenesis
dsu00230  Purine metabolism
dsu00620  Pyruvate metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
dsu01230  Biosynthesis of amino acids
Module
dsu_M00002  Glycolysis, core module involving three-carbon compounds
dsu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
dsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_0052
   00620 Pyruvate metabolism
    Dsui_0052
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dsui_0052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsu04131]
    Dsui_0052
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsu04147]
    Dsui_0052
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Dsui_0052
Membrane trafficking [BR:dsu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dsui_0052
Exosome [BR:dsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dsui_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C DUF3006
Motif
Other DBs
NCBI-ProteinID: AEV24477
UniProt: G8QLE8
LinkDB All DBs
Position
complement(49388..50833)
Genome map
AA seq 481 aa AA seqDB search
MARHTKIVATLGPASTDPVTLERLIRAGVDVVRMNFSHGTAEDHMARARTVREISAKVGR
PVGILGDLQGPKIRVGKFENGKIQLEKGDKFILDANCALGNQERVGLDYKDLPRDVEPGA
VLLLDDGRIVLDVERVIGAEIHTVVRHAGELSNNKGINRQGGGLSAPALTAKDMDDIKTA
AQIGVDYIAVSFPKSAADMYMARQLMRAAGSRALTIAKIERTEAVAALDEILDASDGVMV
ARGDLAVEVGDAAVPALQKKMIRHAREKNKLAITATQMMESMIQSPVPTRAEVSDVANAV
LDGTDAVMLSAETASGRYPVETVESMARVCIEAERSAEVTLDREFLDRVFTRIDQSVAMA
AIWTAHHLKVKAIAALSQSGSTALWMSRLNCGVPVYALTPDAEAQTKMSLYREVTPLLMS
QQHSDRDVLLYEAEQLLMQNGAVAKGDLIVLTIGEPIGTPGGTNTLKIVRVGEHQMPPLR
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccataccaagatcgtcgccaccctcggccccgcttccaccgatcccgtcacc
ctggagcgcctgatccgcgccggcgtggacgtggtgcgcatgaacttctcccacggcacc
gccgaggaccacatggcccgggcccgcaccgtgcgcgagatttccgccaaggtggggcgg
ccggtgggcatcctgggtgacctgcaggggccgaagatccgcgtcggcaaattcgagaac
ggcaagatccagctggagaagggcgacaagttcatcctcgacgccaactgtgccctgggc
aaccaggagcgggtcggcctggactacaaggacctgccccgggacgtggagcccggcgcc
gtgctgctgctggacgacggccgcatcgtgctcgacgtggagcgggtgatcggtgccgaa
atccacaccgtggtgcgccacgccggcgagctgtccaacaacaagggcatcaaccgccag
ggcggcggcctttccgccccggccctgactgccaaggacatggacgacatcaagacggcg
gcccagatcggcgtcgattacatcgccgtctccttccccaagagcgccgccgacatgtac
atggcgcgccagctgatgcgggccgccggcagccgcgccctgaccatcgccaagatcgag
cgcaccgaggccgtggcggccctggatgaaatccttgacgcctccgacggcgtcatggtg
gcccggggcgacctggccgtggaagtgggcgatgccgccgtgccggccctgcagaagaag
atgattcgccacgcccgggagaagaacaagctggccatcaccgccacccagatgatggaa
tccatgatccagtcgccggtgccgacccgggccgaagtgtccgacgtggccaatgcggtg
ctggacggcaccgacgcggtgatgctttccgccgagaccgccagcggccgctatccggtg
gaaaccgtggaatccatggcccgggtctgcatcgaggccgagcgttccgccgaggtgacc
ctggaccgggaattcctcgaccgggtgttcacccgcatcgaccagtccgtggccatggcc
gccatctggaccgcccaccacctcaaggtgaaggccatcgccgccctgtcgcaatccggt
tccaccgccctgtggatgagccgcctcaactgcggcgtgccggtctatgccctgacgccg
gatgcggaggcccagaccaagatgtccctctaccgggaagtgacgcccctgctcatgagc
cagcagcattcggaccgggacgtgctgctctacgaagccgagcagctgctgatgcagaac
ggcgccgtggccaagggcgaccttatcgtgctgaccatcggcgagcccatcggcaccccg
gggggcaccaacaccctgaagatcgtccgcgtcggcgagcaccagatgccgcccctgcgg
gcctga

DBGET integrated database retrieval system