KEGG   Azospira oryzae: Dsui_0361Help
Entry
Dsui_0361         CDS       T01657                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
dsu  Azospira oryzae
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dsu03012]
    Dsui_0361
   03029 Mitochondrial biogenesis [BR:dsu03029]
    Dsui_0361
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dsu04147]
    Dsui_0361
Translation factors [BR:dsu03012]
 Eukaryotic Type
  Elongation factors
   Dsui_0361
 Prokaryotic Type
   Dsui_0361
Mitochondrial biogenesis [BR:dsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dsui_0361
Exosome [BR:dsu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsui_0361
  Exosomal proteins of breast cancer cells
   Dsui_0361
  Exosomal proteins of colorectal cancer cells
   Dsui_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEV24779
UniProt: G8QNY0
LinkDB All DBs
Position
complement(355837..357027)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDIPIVKGSALKALE
GDQSDIGEPAILALADALDSYIPTPERAVDKPFLLPIEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTTKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLAKPGS
ITPHTHFTGEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAISLPEGVEMVMPGDNIQ
MTVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgaacgtacgaagccgcacgttaatgtgggcaccatcggtcac
gttgaccacggtaagaccacgctgactgctgctatcaccaccattctgtccaagaagttc
ggtggcgaagccaaggcttacgaccagatcgacgctgcgcccgaagaaaaggcccgcggt
atcaccatcaacaccgcccacgtcgaatacgaaaccgccacccgtcactacgctcacgtg
gattgcccgggtcacgccgactacgtgaagaacatgattaccggtgccgcccagatggac
ggcgctatcctggtctgttccgccgctgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtgggtgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgaactgctggaactggtcgaaatggaagtgcgcgagctgctctccaag
tacgacttccccggcgacgacatccccatcgtcaagggctccgccctgaaggcgctggaa
ggtgaccagtccgacatcggcgaacccgccattctggccctggccgatgctctggacagc
tacatccccacccccgagcgggctgtggacaagcccttcctgctgcccatcgaagacgtg
ttctccatctccggccgcggtaccgtggtgaccggtcgtgtcgagcgcggcatcgtcaag
gtcggcgaagaaatcgaaatcgtgggtatcaagcccaccaccaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggtgacaacgtgggcgtgctg
ctgcgcggcaccaagcgtgaagaagtcgagcgcggccaagtgctggccaagcccggttcc
atcaccccccacacccacttcactggcgaagtgtatgttctgtccaaggacgaaggtggt
cgtcacaccccgttcttcaacaactaccgtccccagttctacttccggaccactgacgtg
accggcgccatctccctgcccgaaggcgtggaaatggttatgcctggtgacaacattcag
atgaccgtgaagctgatcgctccgatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggcggccgtaccgtcggcgccggtgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system