KEGG   Azospira oryzae: Dsui_0884Help
Entry
Dsui_0884         CDS       T01657                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dsu  Azospira oryzae
Pathway
dsu00970  Aminoacyl-tRNA biosynthesis
dsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dsui_0884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dsu03029]
    Dsui_0884
Enzymes [BR:dsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Dsui_0884
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Dsui_0884
Mitochondrial biogenesis [BR:dsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dsui_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AEV25290
UniProt: G8QID0
LinkDB All DBs
Position
complement(897598..899055)
Genome map
AA seq 485 aa AA seqDB search
MSARNWEVVIGIETHAQLSTQSKIFSGSSTAFGAQPNVQASAVDLALPGVLPVLNRGAVE
CAIKFGLSIGAEVAAKSVFARKNYFYPDLPKGYQISQFELPVVVGGGVRIQVGQGDKAYE
KVVRLTRAHLEEDAGKSLHEDFHGKSGIDLNRAGTPLLEIVTEPDMCSSAEAVAYAKALH
ALVRWIGICDGNMQEGSFRCDANVSVRRPGEPLGTRREIKNLNSFRFLQQAIDYEIQWQI
DTLEDGGKIQQATVLFDPDSGETRVMRTKEDAHDYRYFPDPDLLPLVISREWVERTKATL
PELPEAKRQRFMEQLGLSAYDATALTASLEVADYFDAVVTAAGAANAKSAANWVMGELSA
RLNKEDKDIAASPVSAAQLAGLIARIADNTISNNIAKKVFEALWNGDGASADEVIEKQGL
KQITDTGAIEKLVDEVLAANAANVAEYKAGKEKAFNALVGQVMKAAKGKANPQQVNDLLK
AKLGG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgcaactgggaagtggtcatcggcatcgagacccacgcacagctctccacc
caatccaagattttctcaggctcctccaccgccttcggcgcccagcccaacgtccaggcc
agcgccgtggacctggccctgcccggcgtgctgccggtgctgaaccggggcgccgtggaa
tgcgccatcaagttcggcctctccatcggcgccgaggtggcggcaaagtccgtcttcgcc
cgcaagaactacttctacccggacctgcccaagggctaccagatcagccagttcgagctg
ccggtggtggtgggcggcggtgtgcgcatccaggtcggccagggtgacaaggcttacgag
aaggtggtgcgcctgacccgggcccacctggaagaggatgccggcaagtccctgcacgag
gacttccacggcaagtccggcatcgacctcaaccgggccggcacccccctgctggagatc
gtcaccgagcccgacatgtgctcctccgccgaggccgtggcctacgccaaggccctgcac
gccctggtgcgctggatcggcatctgcgacggcaacatgcaggaaggctccttccgctgc
gacgccaacgtctccgtgcgccgccccggcgagcccctgggcacccgtcgcgaaatcaag
aacctcaactccttccgcttcctgcagcaggccatcgactacgaaatccagtggcagatc
gacaccctggaagacggcggcaagatccagcaggccaccgtgctgttcgacccggattcc
ggcgagacccgggtcatgcgcaccaaggaagacgcccacgactaccgctacttccccgat
cccgacctgctgcccctggtcatctcccgggagtgggtggagcgcaccaaggccaccctg
ccggagctgcccgaggccaagcgccagcgcttcatggagcagctgggcctctccgcctac
gacgccaccgccctcaccgcttccctcgaagtggccgactacttcgacgccgtggtgacc
gccgccggtgcggccaacgccaagagcgccgccaactgggtcatgggcgaactgtccgcc
cgcctcaacaaggaggacaaggacatcgccgcctccccggtgagcgccgcccagctggcc
ggcctcatcgcccgcatcgccgacaacaccatctccaacaacatcgccaagaaggtgttc
gaggccctgtggaacggcgacggcgccagcgccgacgaagtgatcgagaagcagggcctg
aagcagatcaccgacacgggcgccatcgagaaactggtggacgaggtgctggctgccaac
gccgccaacgtggccgagtacaaggccggcaaggaaaaggccttcaacgccctggtgggc
caggtgatgaaggcggccaagggcaaggccaatccccagcaggtgaacgacctgctcaag
gccaagctgggcggctga

DBGET integrated database retrieval system