KEGG   Azospira oryzae: Dsui_0891Help
Entry
Dsui_0891         CDS       T01657                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
dsu  Azospira oryzae
Pathway
dsu00550  Peptidoglycan biosynthesis
dsu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dsui_0891
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Dsui_0891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dsu01011]
    Dsui_0891
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dsui_0891
Peptidoglycan biosynthesis and degradation proteins [BR:dsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Dsui_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AEV25297
UniProt: G8QID7
LinkDB All DBs
Position
904249..906150
Genome map
AA seq 633 aa AA seqDB search
MRYTDLSSSDREQEQFRFRLGFAAGMVLLCFVILFARFFWLQVVKHDYYSTRAEENRISL
VPIIPNRGLIVDRNGVVMARNYSAFTLEITPSRLQEDLETVIEQIGTLIPITPKDRKRFK
KLMEESKNFESIPIRTRLSDDEVARFAANRYRFPGVEVKARLFRQYPLGDVASHALGYMG
RINDKDLETIDNAEQTPNYKGTEHIGKAGLEQNYEFQLHGETGYEEVEVDAGGRAVRVLS
RTAPVSGNNLSLTLDSKLQEITEQAFGSRRGALVAIEPSTGGILALVSKPTYDPNLFVDG
IRGDDWDGLNTDPDKPLLNRAIYSAYPPGSTFKPFMALAALVQGKRTPSQAIADPGYFNF
GGHQFRDDKKGGHGMVDMYKSIVESCDTYYYILANDMGIDNIAAFMGQLGLGQRTGVDIQ
GESEGVLPSQAWKKRRFKKPEHQKWYAGETISIGIGQGYNAYTPIQLAQAVATIANDGVM
YRPHLVKYITNSRSGEKTMVEPQPIRDLKLKPEHLAVIKNAMVGVNKAGTGARAFAGAGY
ESAGKTGTAQVFSLKGEKYVEGATKHHLRDHSLFIAYAPAEQPKIALAVIVENGGFGAAA
AAPIARMVLDYYILGKVPKGPANEDEEGDDGGH
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcgctataccgacctcagcagttcggaccgggaacaggagcagttccgcttccgcctc
ggcttcgccgccggcatggtgctgctgtgcttcgtcatcctcttcgcccgtttcttctgg
ctgcaggtggtgaagcacgactactactccacccgggccgaagagaaccgcatttccctg
gtgcccatcatccccaaccggggcctgatcgtggaccgcaacggggtggtgatggcccgc
aactattccgccttcaccctggaaatcaccccctcccgcctgcaggaagacctggagacg
gtgatcgagcagatcggcaccctgatccctatcacgcccaaggacaggaagcgcttcaag
aaactgatggaggagtcgaagaacttcgagtccatccccatccgcacccgcctttccgac
gacgaggtggcccgctttgccgccaaccgttaccgtttccccggcgtcgaggtgaaggcc
cggctgttccgccagtatcccctgggggacgtggcttcccatgctctgggctacatgggc
cggatcaacgacaaggatctggagaccatcgacaacgccgagcagacgcccaactacaag
ggcaccgagcacatcggcaaggccggcctggagcagaactacgagttccagctgcatggc
gagacgggctacgaggaagtggaagtggatgcgggtggccgggcggtgcgggtgctgtcg
cgcacggcgccggtgtccggcaacaacctgtccttgaccctggactccaagctgcaggag
atcaccgagcaggccttcggcagccgccgcggtgccctggtggccatcgaaccgtccacc
ggcggcatcctggccctggtctccaagcccacctacgaccccaacctgttcgtggacggc
atccgcggcgacgactgggacggcctcaacaccgacccggacaagcccctgctcaaccgg
gccatctactcggcctatccgcccggctccaccttcaagcccttcatggccctggcggcc
ctggtccagggcaagcgcaccccctcccaggccatcgccgatccgggctatttcaacttc
ggcggccaccagttccgggacgacaagaagggcggccacggcatggtggacatgtacaag
tccatcgtcgagtcctgcgatacgtactactacatcctggccaacgacatgggcatcgac
aacatcgccgccttcatgggccagctgggcctgggccagcgcaccggggtggacatccag
ggcgagagcgagggtgtgctgccctcccaggcctggaagaagcgccgcttcaagaagccg
gagcaccagaagtggtatgccggcgaaaccatctccatcggcatcggccagggctacaac
gcctacacgccgatccagctggcccaggcggtggccaccatcgccaacgacggggtcatg
taccggccccatctggtgaagtacatcaccaacagccgcagcggcgagaagaccatggtg
gagccccagcccatccgcgacctcaagctcaagccggaacacctggcggtgatcaagaac
gccatggtcggcgtgaacaaggccggtaccggggcccgggccttcgccggcgccggctac
gaatccgccggcaagaccggtaccgcccaggtgttcagcctgaagggcgagaagtacgtg
gagggcgccaccaagcaccacctgcgcgaccactccctgttcatagcctacgccccggcg
gagcagcccaagatcgccctggcggtgatcgtggagaacggcggtttcggcgccgccgct
gccgcccccatcgcgcgcatggtgctggactactacatcctcggcaaggtgcccaagggc
ccggccaacgaggacgaggagggcgacgatggaggccattag

DBGET integrated database retrieval system